Detail of GM0002
Summary
The genetically modified enzybiotic, named P128 , constructed by Domains Assembly strategy, change or extend lytic spectrum.With P128
Sequence Length: 206 AA.
Mass: 22757.7 Da.
Isoelectric Point: 9.97
Function: The novel chimeric protein P128 is a staphylococcal cell wall-degrading enzyme under development for clearance of S. aureus nasal colonization and MRSA infection.
Construction
GM0002, constructed by Domains Assembly strategy. No schema construted on GM0002
Details:
GM0002[1-144]: derive from protein Q6Y7R1 sequence 669-808
Q6Y7R1, 808 AA., the ORF56 from Staphylococcus phage K
Source: Staphylococcus phage K
Linking to UniprotKB
Linging to InterPro
Domains and repeats
674-805: IPR007921, the CHAP domainGO term prediction
No GO info found on GM0002Linking to UniprotKB
Linging to InterPro
GM0002[145-208]: derive from protein P10547 sequence 411-485
P10547, 493 AA., the Lysostaphin from Staphylococcus simulans
Annotation
1-144
145-208
1-144
: EAD, CHAP domain, derived from the phage tailassociated muralytic enzyme of Phage K;145-208
: CBD, SH3b domain, derived from lysostaphin;Domain and repeats:
145-204
: IPR003646,SH3-like domain, bacterial-type; 6-141
: IPR007921,CHAP domain; GO term prediction:
MSLDSLKKYNGKLPKHDPSFVQPGNRHYKYQCTWYAYNRRGQLGIPVPLWGDAADWIGGAKGAGYGVGRTPKQGACVIWQRGVQGGSPQYGHVAFVEKVLDGGKKIFISEHNYATPNGYGTRTIDMSSAIGKNAQFIYDKK-YKSESASFTPNTDIITRTTGPFRSMPQSGVLKAGQTIHYDEVMKQDGHVWVGYTGNSGQRIYLPV
Production
1. Expressed by inducible T7 expression system in E. coli ER2566, Purified by 0 - 50% ammonium sulphate precipitation then anion exchange columnActivity
1. MIC test on Staphylococcus aureus (Staphylococcus aureus BK#13725) by the CLSI broth microdilutionshowed 2 μg/mL 2. MIC test on Staphylococcus aureus (Staphylococcus aureus BK#9894) by the CLSI broth microdilution
showed 2 ug/mL
Reference
1. Aradhana A Vipra,Srividya N Desai,Panchali Roy,Raghu Patil,Juliet M Raj,Nagalakshmi Narasimhaswamy,V. (2012) Antistaphylococcal activity of bacteriophage derived chimeric protein P128. BMC Microbiology. 2012:41. [doi:10.1186/1471-2180-12-41] [PMID:22439788] [FULL TEXT]2. Paul VD, Rajagopalan SS, Sundarrajan S, George SE, Asrani JY, Pillai R, Chikkamadaiah R, Durgaiah M,. (2011) A novel Bacteriophage Tail Associated Muralytic Enzyme (TAME) from Phage K and its development into a potent antistaphylococcal protein. BMC Microbiol. 110:226. [doi:10.1186/1471-2180-11-226.] [PMID:21985151] [FULL TEXT]