Detail of GM0004


Summary

The genetically modified enzybiotic, named Lambda SA2-E-LysK-SH3b , constructed by Domains Assembly strategy, change or extend lytic spectrum.
With  Lambda SA2-E-LysK-SH3b
  Sequence Length:  218 AA.
  Mass:  24016.7 Da.
  Isoelectric Point:  6.91
  Function:  reduced the S. aureus bacterial load by 1 log units within 3 h

Construction

GM0004, constructed by Domains Assembly strategy.
C5WI88: Putative prophage LambdaSa2, lysin
I6X5A8: LysK
UniProt

IPR008044:5-145
IPR013168:154-192
IPR013169:198-236
IPR002901:270-399
IPR007921:29-160
IPR002502:196-369
IPR003646:409-481
InterPro

GM0004:1-142
GM0004:143-216
GMEnzy

30
60
90
120
150
180
210
240
270
300
330
360
390
420
449
30
60
90
120
150
180
210
240
270
300
330
360
390
420
450
480
495

Details:
GM0004[1-142]: derive from protein C5WI88 sequence 5-145

C5WI88, 449 AA., the Putative prophage LambdaSa2, lysin from Streptococcus dysgalactiae subsp. equisimilis (str

Source: Streptococcus dysgalactiae subsp. equisimilis (str

Domains and repeats

5-145:  IPR008044, the Bacteriophage lysin
6-138:  IPR000064, the Endopeptidase, NLPC/P60 domain
154-192:  IPR013168, the Cpl-7 lysozyme, C-terminal?
198-236:  IPR013169, the Cpl-7 lysozyme, C-terminal?
270-399:  IPR002901, the Mannosyl-glycoprotein endo-beta-N-acetylglucosamid

GO term prediction

Biological Process:  0009253, the peptidoglycan catabolic process
Molecular Function:  0004040, the amidase activity?


Linking to UniprotKB
Linging to InterPro
GM0004[143-216]: derive from protein I6X5A8 sequence 409-481

I6X5A8, 495 AA., the LysK from Staphylococcus phage Fi200W

Source: Staphylococcus phage Fi200W

Domains and repeats

29-160:  IPR007921, the CHAP domain
196-369:  IPR002502, the N-acetylmuramoyl-L-alanine amidase domain
409-481:  IPR003646, the SH3-like domain, bacterial-type?

GO term prediction

Molecular Function:  0008745, the N-acetylmuramoyl-L-alanine amidase activity


Linking to UniprotKB
Linging to InterPro

Annotation

1-142
143-216
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
900
944

1-142
: EAD, Endopeptidase domain, derived from streptococcal ??SA2 endolysin;
143-216
: CBD, SH3b domain, derived from the staphylococcal phage K endolysin(LysK);
Domain and repeats:
1-142
: IPR008044,Bacteriophage lysin;
143-216
: IPR003646,SH3-like domain, bacterial-type?;
2-135
: IPR000064,Endopeptidase, NLPC/P60 domain;
GO term prediction:
TEKAISWMVARQGAVSYSMDYRNGPSSYDCSSAIYYALMSAGTISAGWAVNTEYMHDWLIKNGYVLIAENQDWNSQRGDVVIWGLRGQSAGAGGHVVMFVDSDNIIHCNYANNGITINNYNQTAASAGWMYSYVYRLATPATT-WKKNQYGTWYKPENATFVNGNQPIVTRIGSPFLNAPVGGNLPAGATIVYDEVCIQAGHIWIGYNAYNGNRVYCPV
  BlastP to GMEnzy

Production

  1.  Expressed by pET21a in E. coli BL21 (DE3),  Purified by immobilized metal ion affinity chromatography, using nickel-NTA Superflow resin(QIAGEN, Valencia, CA)

Activity

    No activity data found on GM0004

Reference

  1. Stephen C. Becker, Juli Foster-Frey, Angeline J. Stodola, Daniel Anacker, David M. Donovan. (2009) Differentially conserved staphylococcal SH3b_5 cell wall binding domains confer increased staphylolytic and streptolytic activity to a streptococcal prophage endolysin domain. Gene. 4431-5:32-41. [doi:10.1016/j.gene.2009.04.023] [PMID:19422893]
  2. Mathias Schmelcher, Anne M. Powell, Stephen C. Becker, Mary J. Camp, and David M. Donovan. (2012) Chimeric phage lysins act synergistically with Lysostaphin to kill mastitis causing Staphylococcus aureus in murine mammary glands. Appl. Environ. Microbiol.. 960:729-737. [doi:10.1128/AEM.07050-11] [PMID:22286996] [FULL TEXT]

Comments

  •   [1]  In a mouse model of mastitis, infusion of 25 μg of λSA2-E-Lyso-SH3b or λSA2-E-LysK-SH3b into mammary glands reduced S. aureus CFUs by 0.63 or 0.81 log units, compared to >2 log for lysostaphin
  •   ----  ak0526@163.com   at  2013-09-06 16:08:25


CAPTCHA Image   Reload Image
Enter Code*: