Detail of GM0006
Summary
The genetically modified enzybiotic, named LYZ161 , constructed by Truncation strategy, undisclosed.With LYZ161
Sequence Length: 161 AA.
Mass: 17961.3 Da.
Isoelectric Point: 10.27
Function: could not be detected after nickel column purification of the E. coli
Construction
GM0006, constructed by Truncation strategy. No schema construted on GM0006
Details:
GM0006[1-161]: derive from protein B7T0E8 sequence 475-634
B7T0E8, 634 AA., the Gp58 from Staphylococcus phage phiSauS-IPLA88
Source: Staphylococcus phage phiSauS-IPLA88
483-629: IPR013338, the Lysozyme domain, subfamily 2
Biological Process: 0044036, the cell wall macromolecule metabolic process
Molecular Function: 0004040, the amidase activity?
Molecular Function: 0016787, the hydrolase activity?
Linking to UniprotKB
Linging to InterPro
Domains and repeats
15-149: IPR007921, the CHAP domain483-629: IPR013338, the Lysozyme domain, subfamily 2
GO term prediction
Biological Process: 0009253, the peptidoglycan catabolic processBiological Process: 0044036, the cell wall macromolecule metabolic process
Molecular Function: 0004040, the amidase activity?
Molecular Function: 0016787, the hydrolase activity?
Linking to UniprotKB
Linging to InterPro
Annotation
1-161
1-161
: EAD, lysozyme subfamily 2 lytic domain domain, derived from Staphylococcus aureus bacteriophage vB_SauS-phi-IPLA88 endolysin HydH5;Domain and repeats:
9-156
: IPR013338,Lysozyme domain, subfamily 2; GO term prediction:
0016787, the hydrolase activity
GVSVSSLNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFASGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGVYFTRDKYKL