Detail of GM0007


Summary

The genetically modified enzybiotic, named LYZ171 , constructed by Truncation strategy, undisclosed.
With  LYZ171
  Sequence Length:  168 AA.
  Mass:  18853.4 Da.
  Isoelectric Point:  10.15
  Function:  could not be detected after nickel column purification of the E. coli

Construction

GM0007, constructed by Truncation strategy.
B7T0E8: Gp58
UniProt

IPR007921:15-149
IPR013338:483-629
InterPro

GM0007:1-171
GMEnzy

30
60
90
120
150
180
210
240
270
300
330
360
390
420
450
480
510
540
570
600
630
634

Details:
GM0007[1-171]: derive from protein B7T0E8 sequence 465-634

B7T0E8, 634 AA., the Gp58 from Staphylococcus phage phiSauS-IPLA88

Source: Staphylococcus phage phiSauS-IPLA88

Domains and repeats

15-149:  IPR007921, the CHAP domain
483-629:  IPR013338, the Lysozyme domain, subfamily 2

GO term prediction

Biological Process:  0009253, the peptidoglycan catabolic process
Biological Process:  0044036, the cell wall macromolecule metabolic process
Molecular Function:  0004040, the amidase activity?
Molecular Function:  0016787, the hydrolase activity?


Linking to UniprotKB
Linging to InterPro

Annotation

1-171
50
100
150
200
250
300
350
400
450
500
550
600
634

1-171
: EAD, lysozyme subfamily 2 lytic domain domain, derived from Staphylococcus aureus bacteriophage vB_SauS-phi-IPLA88 endolysin HydH5;
Domain and repeats:
19-166
: IPR013338,Lysozyme domain, subfamily 2;
GO term prediction:
0016787, the hydrolase activity
YQMLNLGVSVSSLNKILKGKGTLNNQGKAFAEACKKHNINEIYLIAHAFLESGYGTSNFASGKDGVYNYFGIGAYDNNPNYAMTFARNKGWTSPAKAIMGGASFVRKDYINKGQNTLYRIRWNPKNPATHQYATAIEWCQHQASTIAKLYKQIGLKGVYFTRDKYKLE
  BlastP to GMEnzy

Production

  1.  Expressed by pET22a in E. coli BL21(DE3),  Purified by NiNTA nickel column chromatography (Qiagen, Valencia, CA).

Activity

    No activity data found on GM0007

Reference

  1. Lorena Rodriguez-Rubio, Beatriz Martinez, Ana Rodriguez1, David M. Donovan, and Pilar Garc¨ªa. (2012) Enhanced staphylolytic activity of the Staphylococcus aureus bacteriophage vB_SauS-phiIPLA88 HydH5 virion associated peptidoglycan hydrolase: fusions, deletions and synergy with LysH5. Appl. Environ. Microbiol.. 4431-2:32-41. [doi:10.1128/AEM.07621-11] [PMID:22267667] [FULL TEXT]

Comments

    No comments found on GM0007


CAPTCHA Image   Reload Image
Enter Code*: