Detail of GM0014
Summary
The genetically modified enzybiotic, named Ply187AN , constructed by Truncation strategy, improve the lytic activity.With Ply187AN
Sequence Length: 156 AA.
Mass: 17744.9 Da.
Isoelectric Point: 9.81
Function: much more active than the full-length protein
Construction
GM0014, constructed by Truncation strategy. No schema construted on GM0014
Details:
GM0014[1-157]: derive from protein O56785 sequence 1-157
O56785, 628 AA., the Cell wall hydrolase Ply187 from Staphylococcus phage 187
Source: Staphylococcus phage 187
476-622: IPR013338, the Lysozyme domain, subfamily 2
14-145: IPR007921, the CHAP domain
476-622: IPR013338, the Lysozyme domain, subfamily 2
Biological Process: 0044036, the cell wall macromolecule metabolic process
Molecular Function: 0004040, the amidase activity?
Molecular Function: 0016787, the hydrolase activity?
Biological Process: 0009253, the peptidoglycan catabolic process
Biological Process: 0044036, the cell wall macromolecule metabolic process?
Molecular Function: 0004040, the amidase activity?
Molecular Function: 0016787, the hydrolase activity?
Linking to UniprotKB
Linging to InterPro
Domains and repeats
11-145: IPR007921, the CHAP domain476-622: IPR013338, the Lysozyme domain, subfamily 2
14-145: IPR007921, the CHAP domain
476-622: IPR013338, the Lysozyme domain, subfamily 2
GO term prediction
Biological Process: 0009253, the peptidoglycan catabolic processBiological Process: 0044036, the cell wall macromolecule metabolic process
Molecular Function: 0004040, the amidase activity?
Molecular Function: 0016787, the hydrolase activity?
Biological Process: 0009253, the peptidoglycan catabolic process
Biological Process: 0044036, the cell wall macromolecule metabolic process?
Molecular Function: 0004040, the amidase activity?
Molecular Function: 0016787, the hydrolase activity?
Linking to UniprotKB
Linging to InterPro
Annotation
1-157
1-157
: EAD, CHAP domain, derived from S. aureus bacteriophage 187 endolysin;Domain and repeats:
11-145
: IPR007921,CHAP domain; 14-145
: IPR007921,CHAP domain; GO term prediction:
MALPKTGKPTAKQVVDWAINLIGSGVDVDGYYGRQCWDLPNYIFNRYWNFKTPGNARDMAWYRYPEGFKVFRNTSDFVPKPGDIAVWTGGNYNWNTWGHTGIVVGPSTKSYFYSVDQNWNNSNSYVGSPAAKIKHSYFGVTHFVRPAYKAEPKPTP
Production
1. Expressed by pET21a in E. coli BL21(DE3), Purified by nickel chromatography Ni-NTA (Qiagen, Valencia, CA)Activity
1. MIC test on Staphylococcus aureus (S. aureus Newman) by microdilution broth methodshowed 53.5±12.0μg/mL(2.8±0.6 nmol/mL)