Detail of GM0014


Summary

The genetically modified enzybiotic, named Ply187AN , constructed by Truncation strategy, improve the lytic activity.
With  Ply187AN
  Sequence Length:  156 AA.
  Mass:  17744.9 Da.
  Isoelectric Point:  9.81
  Function:  much more active than the full-length protein

Construction

GM0014, constructed by Truncation strategy.
O56785: Cell wall hydrolase Ply187
UniProt

IPR007921:11-145
IPR007921:14-145
IPR013338:476-622
IPR013338:476-622
InterPro

GM0014:1-157
GMEnzy

30
60
90
120
150
180
210
240
270
300
330
360
390
420
450
480
510
540
570
600
628

Details:
GM0014[1-157]: derive from protein O56785 sequence 1-157

O56785, 628 AA., the Cell wall hydrolase Ply187 from Staphylococcus phage 187

Source: Staphylococcus phage 187

Domains and repeats

11-145:  IPR007921, the CHAP domain
476-622:  IPR013338, the Lysozyme domain, subfamily 2
14-145:  IPR007921, the CHAP domain
476-622:  IPR013338, the Lysozyme domain, subfamily 2

GO term prediction

Biological Process:  0009253, the peptidoglycan catabolic process
Biological Process:  0044036, the cell wall macromolecule metabolic process
Molecular Function:  0004040, the amidase activity?
Molecular Function:  0016787, the hydrolase activity?
Biological Process:  0009253, the peptidoglycan catabolic process
Biological Process:  0044036, the cell wall macromolecule metabolic process?
Molecular Function:  0004040, the amidase activity?
Molecular Function:  0016787, the hydrolase activity?


Linking to UniprotKB
Linging to InterPro

Annotation

1-157
50
100
150
200
250
300
350
400
450
500
550
600
628

1-157
: EAD, CHAP domain, derived from S. aureus bacteriophage 187 endolysin;
Domain and repeats:
11-145
: IPR007921,CHAP domain;
14-145
: IPR007921,CHAP domain;
GO term prediction:
MALPKTGKPTAKQVVDWAINLIGSGVDVDGYYGRQCWDLPNYIFNRYWNFKTPGNARDMAWYRYPEGFKVFRNTSDFVPKPGDIAVWTGGNYNWNTWGHTGIVVGPSTKSYFYSVDQNWNNSNSYVGSPAAKIKHSYFGVTHFVRPAYKAEPKPTP
  BlastP to GMEnzy

Production

  1.  Expressed by pET21a in E. coli BL21(DE3),  Purified by nickel chromatography Ni-NTA (Qiagen, Valencia, CA)

Activity

  1.  MIC test on Staphylococcus aureus (S. aureus Newman) by microdilution broth method
  showed 53.5±12.0μg/mL(2.8±0.6 nmol/mL)

Reference

  1. Mao, J.Schmelcher, M.Harty, W. J.Foster-Frey, J.Donovan, D. M.. (2013) Chimeric Ply187 endolysin kills Staphylococcus aureus more effectively than the parental enzyme. FEMS Microbiol Lett. 01:30-36. [doi:10.1111/1574-6968.12104] [PMID:23413880] [FULL TEXT]

Comments

    No comments found on GM0014


CAPTCHA Image   Reload Image
Enter Code*: