Detail of GM0016


Summary

The genetically modified enzybiotic, named LysMAcmA-PMBMTH719 fusion protein , constructed by Domains Assembly strategy, change or extend lytic spectrum.
With  LysMAcmA-PMBMTH719 fusion protein
  Sequence Length:  228 AA.
  Mass:  25652.6 Da.
  Isoelectric Point:  10.98
  Function:  The M–P fusion protein is capable of binding to murein,pseudomurein, and chitin

Construction

GM0016, constructed by Domains Assembly strategy.
P0C2T5: Probable N-acetylmuramidase
O26815: Cell surface glycoprotein (S-layer protein)
UniProt

IPR013338:57-214
IPR018392:244-287
IPR018392:320-362
IPR018392:394-437
IPR012334:19-239
IPR012334:255-371
InterPro

GM0016:1-129
GM0016:130-228
GMEnzy

30
60
90
120
150
180
210
240
270
300
330
360
390
420
437
30
60
90
120
150
180
210
240
270
300
330
360
390
420
450
480
510
540
570
574

Details:
GM0016[1-129]: derive from protein P0C2T5 sequence 244-437

P0C2T5, 437 AA., the Probable N-acetylmuramidase from Lactococcus lactis subsp. cremoris (Streptococcus

Source: Lactococcus lactis subsp. cremoris (Streptococcus

Domains and repeats

57-214:  IPR013338, the Lysozyme domain, subfamily 2
244-287:  IPR018392, the LysM domain?
320-362:  IPR018392, the LysM domain?
394-437:  IPR018392, the LysM domain?

GO term prediction

Biological Process:  0009253, the peptidoglycan catabolic process
Biological Process:  0044036, the cell wall macromolecule metabolic process
Biological Process:  0016998, the cell wall macromolecule catabolic process?
Molecular Function:  0004040, the amidase activity?
Molecular Function:  0016787, the hydrolase activity?


Linking to UniprotKB
Linging to InterPro
GM0016[130-228]: derive from protein O26815 sequence 433-574

O26815, 574 AA., the Cell surface glycoprotein (S-layer protein) from Methanothermobacter thermautotrophicus (strain ATC

Source: Methanothermobacter thermautotrophicus (strain ATC

Domains and repeats

19-239:  IPR012334, the Pectin lyase fold
255-371:  IPR012334, the Pectin lyase fold
111-153:  IPR022441, the Parallel beta-helix repeat-2
155-198:  IPR022441, the Parallel beta-helix repeat-2
433-464:  IPR018975, the Pseudomurein-binding repeat
510-538:  IPR018975, the Pseudomurein-binding repeat
543-574:  IPR018975, the Pseudomurein-binding repeat

GO term prediction

    No GO info found on GM0016

Linking to UniprotKB
Linging to InterPro

Annotation

1-129
130-228
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
900
950
1000
1011

1-129
: CBD, Cell wall-targeting domain, derived from autolysin??AcmA?? from Lactococcus lactis;
130-228
: CBD, pseudomurein cell wall-binding domain, derived from S-layer protein MTH719 from Methanothermobacter thermautotrophicus;
Domain and repeats:
1--21
: IPR018392,LysM domain?;
130-118
: IPR018975,Pseudomurein-binding repeat;
151-129
: IPR018392,LysM domain?;
207-192
: IPR018975,Pseudomurein-binding repeat;
240-228
: IPR018975,Pseudomurein-binding repeat;
77-54
: IPR018392,LysM domain?;
GO term prediction:
YTVKSGDTLWGISQRYGISVAQIQSANNLKSTIIYIGQKLVLT-VKVKSGDTLWALSVKYKTSIAQLKSWNHLSSDTIYIGQNLIVS-HKVVKGDTLWGLSQKSGSPIASIKAWNHLSSDTILIGQYLRIK-ASVKISVRQLTDAASWVRAYYGRYGRLPGKVTI-RHGRLYRSSYVRVAKNILSFIDSRGRAPNYAIT-GLGRIPFQRLVYMYSKIIKFYGTNKRLPNYVTI
  BlastP to GMEnzy

Production

  1.  Expressed by in E. coli Rosetta gami 2,  Purified by NiNTA nickel column chromatography ((Ni-NTA superflow,QiagenGmbH,Hilden, Germany).

Activity

    No activity data found on GM0016

Reference

  1. Visweswaran, G. R.Dijkstra, B. W.Kok, J.. (2012) A genetically engineered protein domain binding to bacterial murein, archaeal pseudomurein, and fungal chitin cell wall material. Applied microbiology and biotechnology. 03:729-737. [doi:10.1007/s00253-012-3871-0] [PMID:22262228] [FULL TEXT]

Comments

    No comments found on GM0016


CAPTCHA Image   Reload Image
Enter Code*: