Detail of GM0017


Summary

The genetically modified enzybiotic, named CSCD , constructed by Domains Assembly strategy, keep the lytic activity.
With  CSCD
  Sequence Length:  328 AA.
  Mass:  36089.7 Da.
  Isoelectric Point:  8.5
  Function:  exhibit lytic activity against cells of C. sporogenes

Construction

GM0017, constructed by Domains Assembly strategy.
I1TJX3: Endolysin CS74L
T4YXV2: N-acetylmuramoyl-L-alanine amidase family protein
UniProt

IPR002508:2-167
IPR002508:1-175
InterPro

GM0017:1-177
GM0017:178-267
GMEnzy

30
60
90
120
150
180
210
240
264
30
60
90
120
150
180
210
240
270

Details:
GM0017[1-177]: derive from protein I1TJX3 sequence 1-177

I1TJX3, 264 AA., the Endolysin CS74L from Clostridium phage phi8074-B1

Source: Clostridium phage phi8074-B1

Domains and repeats

2-167:  IPR002508, the Cell wall hydrolase/autolysin, catalytic

GO term prediction

Biological Process:  0009253, the peptidoglycan catabolic process
Molecular Function:  0008745, the N-acetylmuramoyl-L-alanine amidase activity?


Linking to UniprotKB
Linging to InterPro
GM0017[178-267]: derive from protein T4YXV2 sequence 180-270

T4YXV2, 270 AA., the N-acetylmuramoyl-L-alanine amidase family protein from Clostridium difficile CD92

Source: Clostridium difficile CD92

Domains and repeats

1-175:  IPR002508, the Cell wall hydrolase/autolysin, catalytic

GO term prediction

Biological Process:  0009253, the peptidoglycan catabolic process
Molecular Function:  0008745, the N-acetylmuramoyl-L-alanine amidase activity?


Linking to UniprotKB
Linging to InterPro

Annotation

1-177
178-267
50
100
150
200
250
300
350
400
450
500
534

1-177
: EAD, Amidase domain, derived from Lytic bacteriophage ATCC 8074-B1 endolysin CS74L;
178-267
: CBD, Cell wall-targeting domain, derived from Clostridium difficile bacteriophage CD27 endolysin CD27L;
Domain and repeats:
2-167
: IPR002508,Cell wall hydrolase/autolysin, catalytic;
GO term prediction:
0008745, the N-acetylmuramoyl-L-alanine amidase activity
0009253, the peptidoglycan catabolic process
MKIGIDMGHTLSGADYGVVGLRPESVLTREVGTKVIYKLQKLGHVVVNCTVDKASSVSESLYTRYYRANQANVDLFISIHFNATPGGTGTEVYTYAGRQLGEATRIRQEFKSLGLRDRGTKDGSGLAVIRNTKAKAMLVECCFCDNPNDMKLYNSESFSNAIVKGITGKLPNGESGNNNQGGNKVKAVVIYNEGADRRGAEYLADYLNCPTISNSRTFDYSCVEHVYAVGGKKEQYT-NEGVKQMYKHTIVYDGEVDKISATVVGWGYNDGKILICDIKDYVPGQTQNLYVVGGGACEKISSITKEKFIMIKGNDRFDTLYKALDFINR
  BlastP to GMEnzy

Production

  1.  Expressed by pET15b in E. coli BL21(DE3),  Purified by NiNTA nickel column chromatography

Activity

    No activity data found on GM0017

Reference

  1. Mayer, M. J.Gasson, M. J.Narbad, A.. (2012) Genomic sequence of bacteriophage ATCC 8074-B1 and activity of its endolysin and engineered variants against Clostridium sporogenes. Applied and environmental microbiology. 010:3685-3692. [doi:10.1128/AEM.07884-11] [PMID:22427494] [FULL TEXT]

Comments

    No comments found on GM0017


CAPTCHA Image   Reload Image
Enter Code*: