Detail of GM0018


Summary

The genetically modified enzybiotic, named CS74L1-177 , constructed by Truncation strategy, keep the lytic activity.
With  CS74L1-177
  Sequence Length:  237 AA.
  Mass:  25866 Da.
  Isoelectric Point:  8.72
  Function:  exhibit lytic activity against cells of C. sporogenes.

Construction

GM0018, constructed by Truncation strategy.
I1TJX3: Endolysin CS74L
UniProt

IPR002508:2-167
InterPro

GM0018:1-177
GMEnzy

30
60
90
120
150
180
210
240
264

Details:
GM0018[1-177]: derive from protein I1TJX3 sequence 1-177

I1TJX3, 264 AA., the Endolysin CS74L from Clostridium phage phi8074-B1

Source: Clostridium phage phi8074-B1

Domains and repeats

2-167:  IPR002508, the Cell wall hydrolase/autolysin, catalytic

GO term prediction

Biological Process:  0009253, the peptidoglycan catabolic process
Molecular Function:  0008745, the N-acetylmuramoyl-L-alanine amidase activity?


Linking to UniprotKB
Linging to InterPro

Annotation

1-177
50
100
150
200
250
264

1-177
: EAD, Amidase domain, derived from Lytic bacteriophage ATCC 8074-B1 endolysin CS74L;
Domain and repeats:
2-167
: IPR002508,Cell wall hydrolase/autolysin, catalytic;
GO term prediction:
0008745, the N-acetylmuramoyl-L-alanine amidase activity
0009253, the peptidoglycan catabolic process
MKIGIDMGHTLSGADYGVVGLRPESVLTREVGTKVIYKLQKLGHVVVNCTVDKASSVSESLYTRYYRANQANVDLFISIHFNATPGGTGTEVYTYAGRQLGEATRIRQEFKSLGLRDRGTKDGSGLAVIRNTKAKAMLVECCFCDNPNDMKLYNSESFSNAIVKGITGKLPNGESGNNNQGGNKVKAVVIYNEGADRRGAEYLADYLNCPTISNSRTFDYSCVEHVYAVGGKKEQYT
  BlastP to GMEnzy

Production

  1.  Expressed by pET15b in E. coli BL21(DE3),  Purified by NiNTA nickel column chromatography

Activity

    No activity data found on GM0018

Reference

  1. Mayer, M. J.Gasson, M. J.Narbad, A.. (2012) Genomic sequence of bacteriophage ATCC 8074-B1 and activity of its endolysin and engineered variants against Clostridium sporogenes. Applied and environmental microbiology. 010:3685-3692. [doi:10.1128/AEM.07884-11] [PMID:22427494] [FULL TEXT]

Comments

    No comments found on GM0018


CAPTCHA Image   Reload Image
Enter Code*: