Detail of GM0020
Summary
The genetically modified enzybiotic, named Lys170-87 , constructed by Domains Assembly strategy, enhance the solubility,change or extend lytic spectrum.With Lys170-87
Sequence Length: 286 AA.
Mass: 30879.6 Da.
Isoelectric Point: 7.81
Function: very effective in lysing S. aureus clinical isolates,Lys168-87 again showed a better lytic performance.
Construction
GM0020, constructed by Domains Assembly strategy. No schema construted on GM0020
Details:
GM0020[1-182]: derive from protein A8E261 sequence 1-182
A8E261, 289 AA., the Putative N-acetylmuramoyl-L-alanine amidase from Enterococcus phage phiEF24C (Enterococcus bacterio
Source: Enterococcus phage phiEF24C (Enterococcus bacterio
Molecular Function: 0008745, the N-acetylmuramoyl-L-alanine amidase activity?
Linking to UniprotKB
Linging to InterPro
Domains and repeats
18-168: IPR002502, the N-acetylmuramoyl-L-alanine amidase domainGO term prediction
Biological Process: 0009253, the peptidoglycan catabolic processMolecular Function: 0008745, the N-acetylmuramoyl-L-alanine amidase activity?
Linking to UniprotKB
Linging to InterPro
GM0020[183-287]: derive from protein U5T1I9 sequence 148-251
U5T1I9, 251 AA., the Phage lysin, N-acetylmuramoyl-L-alanine amidase from Staphylococcus aureus subsp. aureus Z172
Source: Staphylococcus aureus subsp. aureus Z172
Linking to UniprotKB
Linging to InterPro
Domains and repeats
4-133: IPR007921, the CHAP domainGO term prediction
No GO info found on GM0020Linking to UniprotKB
Linging to InterPro
Annotation
1-182
183-287
1-172
: EAD, Amidase domain, derived from Enterococcus faecalis phage F170/08 endolysins Lys170;207-286
: CBD, Cell wall-targeting domain, derived from staphylococcal phage endolysin Lys87;Domain and repeats:
18-168
: IPR002502,N-acetylmuramoyl-L-alanine amidase domain; GO term prediction:
0008745, the N-acetylmuramoyl-L-alanine amidase activity
0009253, the peptidoglycan catabolic process
MAGEVFSSLITSVNPNPMNAGSRNGIPIDTIILHHNATTNKDVAMNTWLLGGGAGTSAHYECTPTEIIGCVGEQYSAFHAGGTGGIDVPKIANPNQRSIGIENVNSSGAPNWSVDPRTITNCARLVADICTRYGIPCDRQHVLGHNEVTATACPGGMDVDEVVRQAQQFMAGGSNNAVKPEP-KVKPPAQKAVGKSASKITVGSKAPYNLKWSKGAYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDGWCRIYWNNHNEWIWHERLIVKEVF
Production
1. Expressed by pIVEX2.3d in E. coli XL1-Blue, Purified by affinity chromatography using HisTrapTM HP columns (GE Healthcare) coupled to an KTA-Prime system(GEHealthcare).Activity
No activity data found on GM0020Reference
1. Fernandes, S.Proenca, D.Cantante, C.Silva, F. A.Leandro, C.Lourenco, S.Milheirico, C.de Lencastre, H. (2012) Novel chimerical endolysins with broad antimicrobial activity against methicillin-resistant Staphylococcus aureus. . 03:333-343. [doi:10.1089/mdr.2012.0025] [PMID:22432707]Comments
- [1] Lovely material. Cheers. reddit best resume writing service essay writing prompts definition of essay writing
- ---- hectorVow@eseomail.com at 2023-08-02 10:13:28
- [2] Really lots of fantastic advice. college papers writing service best college essay writing service essay writing service dublin
- ---- charlesZen@gseomail.com at 2023-07-29 14:56:25