Detail of GM0020


Summary

The genetically modified enzybiotic, named Lys170-87 , constructed by Domains Assembly strategy, enhance the solubility,change or extend lytic spectrum.
With  Lys170-87
  Sequence Length:  286 AA.
  Mass:  30879.6 Da.
  Isoelectric Point:  7.81
  Function:  very effective in lysing S. aureus clinical isolates,Lys168-87 again showed a better lytic performance.

Construction

GM0020, constructed by Domains Assembly strategy.
A8E261: Putative N-acetylmuramoyl-L-alanine amidase
U5T1I9: Phage lysin, N-acetylmuramoyl-L-alanine amidase
UniProt

IPR002502:18-168
IPR007921:4-133
InterPro

GM0020:1-182
GM0020:183-287
GMEnzy

30
60
90
120
150
180
210
240
270
289
30
60
90
120
150
180
210
240
251

Details:
GM0020[1-182]: derive from protein A8E261 sequence 1-182

A8E261, 289 AA., the Putative N-acetylmuramoyl-L-alanine amidase from Enterococcus phage phiEF24C (Enterococcus bacterio

Source: Enterococcus phage phiEF24C (Enterococcus bacterio

Domains and repeats

18-168:  IPR002502, the N-acetylmuramoyl-L-alanine amidase domain

GO term prediction

Biological Process:  0009253, the peptidoglycan catabolic process
Molecular Function:  0008745, the N-acetylmuramoyl-L-alanine amidase activity?


Linking to UniprotKB
Linging to InterPro
GM0020[183-287]: derive from protein U5T1I9 sequence 148-251

U5T1I9, 251 AA., the Phage lysin, N-acetylmuramoyl-L-alanine amidase from Staphylococcus aureus subsp. aureus Z172

Source: Staphylococcus aureus subsp. aureus Z172

Domains and repeats

4-133:  IPR007921, the CHAP domain

GO term prediction

    No GO info found on GM0020

Linking to UniprotKB
Linging to InterPro

Annotation

1-182
183-287
50
100
150
200
250
300
350
400
450
500
540

1-172
: EAD, Amidase domain, derived from Enterococcus faecalis phage F170/08 endolysins Lys170;
207-286
: CBD, Cell wall-targeting domain, derived from staphylococcal phage endolysin Lys87;
Domain and repeats:
18-168
: IPR002502,N-acetylmuramoyl-L-alanine amidase domain;
GO term prediction:
0008745, the N-acetylmuramoyl-L-alanine amidase activity
0009253, the peptidoglycan catabolic process
MAGEVFSSLITSVNPNPMNAGSRNGIPIDTIILHHNATTNKDVAMNTWLLGGGAGTSAHYECTPTEIIGCVGEQYSAFHAGGTGGIDVPKIANPNQRSIGIENVNSSGAPNWSVDPRTITNCARLVADICTRYGIPCDRQHVLGHNEVTATACPGGMDVDEVVRQAQQFMAGGSNNAVKPEP-KVKPPAQKAVGKSASKITVGSKAPYNLKWSKGAYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDGWCRIYWNNHNEWIWHERLIVKEVF
  BlastP to GMEnzy

Production

  1.  Expressed by pIVEX2.3d in E. coli XL1-Blue,  Purified by affinity chromatography using HisTrapTM HP columns (GE Healthcare) coupled to an KTA-Prime system(GEHealthcare).

Activity

    No activity data found on GM0020

Reference

  1. Fernandes, S.Proenca, D.Cantante, C.Silva, F. A.Leandro, C.Lourenco, S.Milheirico, C.de Lencastre, H. (2012) Novel chimerical endolysins with broad antimicrobial activity against methicillin-resistant Staphylococcus aureus. . 03:333-343. [doi:10.1089/mdr.2012.0025] [PMID:22432707]

Comments

    No comments found on GM0020


CAPTCHA Image   Reload Image
Enter Code*: