Detail of GM0022
Summary
The genetically modified enzybiotic, named CD27L(1-179) , constructed by Truncation strategy, improve the lytic activity.With CD27L(1-179)
Sequence Length: 179 AA.
Mass: 19891.7 Da.
Isoelectric Point: 9.29
Function: has increased lytic activity against cells of C. difficil also has increased activity against other bacterial species that are targeted by the full-length protein and in addition was able to lyse some CD27L-insensitive strains.
Construction
GM0022, constructed by Truncation strategy. No schema construted on GM0022
Details:
GM0022[1-179]: derive from protein T4YXV2 sequence 1-179
T4YXV2, 270 AA., the N-acetylmuramoyl-L-alanine amidase family protein from Clostridium difficile CD92
Source: Clostridium difficile CD92
Molecular Function: 0008745, the N-acetylmuramoyl-L-alanine amidase activity?
Linking to UniprotKB
Linging to InterPro
Domains and repeats
1-175: IPR002508, the Cell wall hydrolase/autolysin, catalyticGO term prediction
Biological Process: 0009253, the peptidoglycan catabolic processMolecular Function: 0008745, the N-acetylmuramoyl-L-alanine amidase activity?
Linking to UniprotKB
Linging to InterPro
Annotation
1-179
1-179
: EAD, Cell wall-targeting domain, derived from Clostridium difficile Endolysin CD27L;Domain and repeats:
1-175
: IPR002508,Cell wall hydrolase/autolysin, catalytic; GO term prediction:
0008745, the N-acetylmuramoyl-L-alanine amidase activity
0009253, the peptidoglycan catabolic process
MKICITVGHSILKSGACTSADGVVNEYQYNKSLAPVLADTFRKEGHKVDVIICPEKQFKTKNEEKSYKIPRVNSGGYDLLIELHLNASNGQGKGSEVLYYSNKGLEYATRICDKLGTVFKNRGAKLDKRLYILNSSKPTAVLIESFFCDNKEDYDKAKKLGHEGIAKLIVEGVLNKNIN