Detail of GM0022


Summary

The genetically modified enzybiotic, named CD27L(1-179) , constructed by Truncation strategy, improve the lytic activity.
With  CD27L(1-179)
  Sequence Length:  179 AA.
  Mass:  19891.7 Da.
  Isoelectric Point:  9.29
  Function:  has increased lytic activity against cells of C. difficil also has increased activity against other bacterial species that are targeted by the full-length protein and in addition was able to lyse some CD27L-insensitive strains.

Construction

GM0022, constructed by Truncation strategy.
T4YXV2: N-acetylmuramoyl-L-alanine amidase family protein
UniProt

IPR002508:1-175
InterPro

GM0022:1-179
GMEnzy

30
60
90
120
150
180
210
240
270

Details:
GM0022[1-179]: derive from protein T4YXV2 sequence 1-179

T4YXV2, 270 AA., the N-acetylmuramoyl-L-alanine amidase family protein from Clostridium difficile CD92

Source: Clostridium difficile CD92

Domains and repeats

1-175:  IPR002508, the Cell wall hydrolase/autolysin, catalytic

GO term prediction

Biological Process:  0009253, the peptidoglycan catabolic process
Molecular Function:  0008745, the N-acetylmuramoyl-L-alanine amidase activity?


Linking to UniprotKB
Linging to InterPro

Annotation

1-179
50
100
150
200
250
270

1-179
: EAD, Cell wall-targeting domain, derived from Clostridium difficile Endolysin CD27L;
Domain and repeats:
1-175
: IPR002508,Cell wall hydrolase/autolysin, catalytic;
GO term prediction:
0008745, the N-acetylmuramoyl-L-alanine amidase activity
0009253, the peptidoglycan catabolic process
MKICITVGHSILKSGACTSADGVVNEYQYNKSLAPVLADTFRKEGHKVDVIICPEKQFKTKNEEKSYKIPRVNSGGYDLLIELHLNASNGQGKGSEVLYYSNKGLEYATRICDKLGTVFKNRGAKLDKRLYILNSSKPTAVLIESFFCDNKEDYDKAKKLGHEGIAKLIVEGVLNKNIN
  BlastP to GMEnzy

Production

  1.  Expressed by pET15b in E. coli BL21(DE3),  Purified by Ni-nitrilotriacetic acid (NTA) columns

Activity

    No activity data found on GM0022

Reference

  1. Mayer, M. J.Garefalaki, V.Spoerl, R.Narbad, A.Meijers, R.. (2011) Structure-based modification of a Clostridium difficile-targeting endolysin affects activity and host range.. Journal of bacteriology. 019:5477-5486. [doi:10.1128/JB.00439-11] [PMID:21803993] [FULL TEXT]

Comments

    No comments found on GM0022


CAPTCHA Image   Reload Image
Enter Code*: