Detail of GM0024
Summary
The genetically modified enzybiotic, named C-A462 , constructed by Truncation strategy, lose the activities of cell targeting.With C-A462
Sequence Length: 462 AA.
Mass: 51089.4 Da.
Isoelectric Point: 9.94
Function: Zymogram activity show zone of clearing
Construction
GM0024, constructed by Truncation strategy. No schema construted on GM0024
Details:
GM0024[1-462]: derive from protein I6X5A8 sequence 1-462
I6X5A8, 495 AA., the LysK from Staphylococcus phage Fi200W
Source: Staphylococcus phage Fi200W
196-369: IPR002502, the N-acetylmuramoyl-L-alanine amidase domain
409-481: IPR003646, the SH3-like domain, bacterial-type?
Linking to UniprotKB
Linging to InterPro
Domains and repeats
29-160: IPR007921, the CHAP domain196-369: IPR002502, the N-acetylmuramoyl-L-alanine amidase domain
409-481: IPR003646, the SH3-like domain, bacterial-type?
GO term prediction
Molecular Function: 0008745, the N-acetylmuramoyl-L-alanine amidase activityLinking to UniprotKB
Linging to InterPro
Annotation
1-462
35-160
: EAD, CHAP domain, derived from phage endolysin LysK;197-346
: EAD, amidase-2 domain, derived from phage endolysin LysK;Domain and repeats:
196-369
: IPR002502,N-acetylmuramoyl-L-alanine amidase domain; 29-160
: IPR007921,CHAP domain; GO term prediction:
0008745, the N-acetylmuramoyl-L-alanine amidase activity
0009253, the peptidoglycan catabolic process
MAKTQAEINKRLDAYAKGTVDSPYRVKKATSYDPSFGVMEAGAIDADGYYHAQCQDLITDYVLWLTDNKVRTWGNAKDQIKQSYGTGFKIHENKPSTVPKKGWIAVFTSGSYEQWGHIGIVYDGGNTSTFTILEQNWNGYANKKPTKRVDNYYGLTHFIEIPVKAGTTVKKETAKKSASKTPAPKKKATLKVSKNHINYTMDKRGKKPEGMVIHNDAGRSSGQQYENSLANAGYARYANGIAHYYGSEGYVWEAIDAKNQIAWHTGDGTGANSGNFRFAGIEVCQSMSASDAQFLKNEQAVFQFTAEKFKEWGLTPNRKTVRLHMEFVPTACPHRSMVLHTGFNPVTQGRPSQAIMNKLKDYFIKQIKNYMDKGTSSSTVVKDGKTSSASTPATRPVTGSWKKNQYGTWYKPENATFVNGNQPIVTRIGSPFLNAPVGGNLPAGATIVYDEVCIQAGHIWIG