Detail of GM0025


Summary

The genetically modified enzybiotic, named A-S391 , constructed by Truncation strategy, lose the activities of cell targeting.
With  A-S391
  Sequence Length:  391 AA.
  Mass:  43052.4 Da.
  Isoelectric Point:  10.04
  Function:  Zymogram activity show no zone of clearing

Construction

GM0025, constructed by Truncation strategy.
I6X5A8: LysK
UniProt

IPR007921:29-160
IPR002502:196-369
IPR003646:409-481
InterPro

GM0025:1-391
GMEnzy

30
60
90
120
150
180
210
240
270
300
330
360
390
420
450
480
495

Details:
GM0025[1-391]: derive from protein I6X5A8 sequence 105-495

I6X5A8, 495 AA., the LysK from Staphylococcus phage Fi200W

Source: Staphylococcus phage Fi200W

Domains and repeats

29-160:  IPR007921, the CHAP domain
196-369:  IPR002502, the N-acetylmuramoyl-L-alanine amidase domain
409-481:  IPR003646, the SH3-like domain, bacterial-type?

GO term prediction

Molecular Function:  0008745, the N-acetylmuramoyl-L-alanine amidase activity


Linking to UniprotKB
Linging to InterPro

Annotation

1-391
50
100
150
200
250
300
350
400
450
495

92-241
: EAD, amidase-2 domain, derived from phage endolysin LysK;
307-376
: CBD, SH3b domain, derived from phage endolysin LysK;
Domain and repeats:
305-377
: IPR003646,SH3-like domain, bacterial-type?;
92-265
: IPR002502,N-acetylmuramoyl-L-alanine amidase domain;
GO term prediction:
0008745, the N-acetylmuramoyl-L-alanine amidase activity
0009253, the peptidoglycan catabolic process
AVFTSGSYEQWGHIGIVYDGGNTSTFTILEQNWNGYANKKPTKRVDNYYGLTHFIEIPVKAGTTVKKETAKKSASKTPAPKKKATLKVSKNHINYTMDKRGKKPEGMVIHNDAGRSSGQQYENSLANAGYARYANGIAHYYGSEGYVWEAIDAKNQIAWHTGDGTGANSGNFRFAGIEVCQSMSASDAQFLKNEQAVFQFTAEKFKEWGLTPNRKTVRLHMEFVPTACPHRSMVLHTGFNPVTQGRPSQAIMNKLKDYFIKQIKNYMDKGTSSSTVVKDGKTSSASTPATRPVTGSWKKNQYGTWYKPENATFVNGNQPIVTRIGSPFLNAPVGGNLPAGATIVYDEVCIQAGHIWIGYNAYNGNRVYCPVRTCQGVPPNQIPGVAWGVFK
  BlastP to GMEnzy

Production

  1.  Expressed by pQE60 in E. coli XL1-Blue,  Purified by ion-exchange and size exclusion chromatography

Activity

    No activity data found on GM0025

Reference

    No reference found on GM0025

Comments

    No comments found on GM0025


CAPTCHA Image   Reload Image
Enter Code*: