Detail of GM0029


Summary

The genetically modified enzybiotic, named P16-17 , constructed by Domains Assembly strategy, enhance the solubility.
With  P16-17
  Sequence Length:  166 AA.
  Mass:  19033.2 Da.
  Isoelectric Point:  8.05
  Function:  enhance the solubility,augment the antimicrobial efficacy of the antibiotic gentamicin

Construction

GM0029, constructed by Domains Assembly strategy.
Q859I7: Amidase
Q859I6: Minor structural protein
UniProt

IPR007921:4-134
IPR003646:164-269
InterPro

GM0029:1-141
GM0029:142-168
GMEnzy

30
60
90
120
150
180
210
240
250
30
60
90
120
150
180
210
240
270
300
330
360
390
420
450
480
510
540
570
600
630
647

Details:
GM0029[1-141]: derive from protein Q859I7 sequence 1-141

Q859I7, 250 AA., the Amidase from Staphylococcus phage P68

Source: Staphylococcus phage P68

Domains and repeats

4-134:  IPR007921, the CHAP domain
164-269:  IPR003646, the SH3-like domain, bacterial-type

GO term prediction

    No GO info found on GM0029

Linking to UniprotKB
Linging to InterPro
GM0029[142-168]: derive from protein Q859I6 sequence 623-647

Q859I6, 647 AA., the Minor structural protein from Staphylococcus phage P68

Source: Staphylococcus phage P68

Domains and repeats

    No sequence info found on GM0029

GO term prediction

    No GO info found on GM0029

Linking to UniprotKB
Linging to InterPro

Annotation

1-141
142-168
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
897

1-141
: EAD, CHAP domain, derived from S. aureus phage P68 endolysin (Lys16);
142-168
: CBD, Cell wall-targeting domain, derived from S. aureus phage P68 endolysin (P17);
Domain and repeats:
4-134
: IPR007921,CHAP domain;
GO term prediction:
MKSQQQAKEWIYKHEGAGVDFDGAYGFQCMDLSVAYVYYITDGKVRMWGNAKDAINNDFKGLATVYKNTPSFKPQLGDVAVYTNGQYGHIQCVLSGNLDYYTCLEQNWLGGGFDGWEKATIRTHYYDGVTHFIRPKFSGSN-YKEFFSNVNAETKHREYGWVAKHQK
  BlastP to GMEnzy

Production

  1.  Expressed by pQE30 in E. coli XL-1 Blue,  Purified by Ni-NTA agarose (Qiagen)

Activity

    No activity data found on GM0029

Reference

  1. Manoharadas, S.Witte, A.Blasi, U.. (2009) Antimicrobial activity of a chimeric enzybiotic towards Staphylococcus aureus. Journal of biotechnology. 01:118-123. [doi:10.1016/j.jbiotec.2008.09.003] [PMID:18940209]

Comments

    No comments found on GM0029


CAPTCHA Image   Reload Image
Enter Code*: