Detail of GM0029
Summary
The genetically modified enzybiotic, named P16-17 , constructed by Domains Assembly strategy, enhance the solubility.With P16-17
Sequence Length: 166 AA.
Mass: 19033.2 Da.
Isoelectric Point: 8.05
Function: enhance the solubility,augment the antimicrobial efficacy of the antibiotic gentamicin
Construction
GM0029, constructed by Domains Assembly strategy. No schema construted on GM0029
Details:
GM0029[1-141]: derive from protein Q859I7 sequence 1-141
Q859I7, 250 AA., the Amidase from Staphylococcus phage P68
Source: Staphylococcus phage P68
164-269: IPR003646, the SH3-like domain, bacterial-type
Linking to UniprotKB
Linging to InterPro
Domains and repeats
4-134: IPR007921, the CHAP domain164-269: IPR003646, the SH3-like domain, bacterial-type
GO term prediction
No GO info found on GM0029Linking to UniprotKB
Linging to InterPro
GM0029[142-168]: derive from protein Q859I6 sequence 623-647
Q859I6, 647 AA., the Minor structural protein from Staphylococcus phage P68
Source: Staphylococcus phage P68
Linking to UniprotKB
Linging to InterPro
Domains and repeats
No sequence info found on GM0029GO term prediction
No GO info found on GM0029Linking to UniprotKB
Linging to InterPro
Annotation
1-141
142-168
1-141
: EAD, CHAP domain, derived from S. aureus phage P68 endolysin (Lys16);142-168
: CBD, Cell wall-targeting domain, derived from S. aureus phage P68 endolysin (P17);Domain and repeats:
4-134
: IPR007921,CHAP domain; GO term prediction:
MKSQQQAKEWIYKHEGAGVDFDGAYGFQCMDLSVAYVYYITDGKVRMWGNAKDAINNDFKGLATVYKNTPSFKPQLGDVAVYTNGQYGHIQCVLSGNLDYYTCLEQNWLGGGFDGWEKATIRTHYYDGVTHFIRPKFSGSN-YKEFFSNVNAETKHREYGWVAKHQK