Detail of GM0036
Summary
The genetically modified enzybiotic, named LysK149-495 , constructed by Truncation strategy, decrease the lytic activity.With LysK149-495
Sequence Length: 209 AA.
Mass: 23120 Da.
Isoelectric Point: 10.05
Function: show faint activity in both the zymogram and turbidity reduction assays, but no detectable activity in either plate lysis or MIC assays
Construction
GM0036, constructed by Truncation strategy. No schema construted on GM0036
Details:
GM0036[1-347]: derive from protein I6X5A8 sequence 149-495
I6X5A8, 495 AA., the LysK from Staphylococcus phage Fi200W
Source: Staphylococcus phage Fi200W
196-369: IPR002502, the N-acetylmuramoyl-L-alanine amidase domain
409-481: IPR003646, the SH3-like domain, bacterial-type?
Linking to UniprotKB
Linging to InterPro
Domains and repeats
29-160: IPR007921, the CHAP domain196-369: IPR002502, the N-acetylmuramoyl-L-alanine amidase domain
409-481: IPR003646, the SH3-like domain, bacterial-type?
GO term prediction
Molecular Function: 0008745, the N-acetylmuramoyl-L-alanine amidase activityLinking to UniprotKB
Linging to InterPro
Annotation
1-347
48-194
: EAD, Amidase domain, derived from staphylococcal bacteriophage endolysin LysK;260-326
: CBD, SH3b domain, derived from staphylococcal bacteriophage endolysin LysK;Domain and repeats:
261-333
: IPR003646,SH3-like domain, bacterial-type?; 48-221
: IPR002502,N-acetylmuramoyl-L-alanine amidase domain; GO term prediction:
0008745, the N-acetylmuramoyl-L-alanine amidase activity
0009253, the peptidoglycan catabolic process
VDNYYGLTHFIEIPVKAGTTVKKETAKKSASKTPAPKKKATLKVSKNHINYTMDKRGKKPEGMVIHNDAGRSSGQQYENSLANAGYARYANGIAHYYGSEGYVWEAIDAKNQIAWHTGDGTGANSGNFRFAGIEVCQSMSASDAQFLKNEQAVFQFTAEKFKEWGLTPNRKTVRLHMEFVPTACPHRSMVLHTGFNPVTQGRPSQAIMN