Detail of GM0044
Summary
The genetically modified enzybiotic, named lambdaSa2-G , constructed by Truncation strategy, decrease the lytic activity.With lambdaSa2-G
Sequence Length: 210 AA.
Mass: 22608.3 Da.
Isoelectric Point: 5.3
Function: showed very little activity in the turbidity reduction assay
Construction
GM0044, constructed by Truncation strategy. No schema construted on GM0044
Details:
GM0044[40-476]: derive from protein C5WI88 sequence 5-145
C5WI88, 449 AA., the Putative prophage LambdaSa2, lysin from Streptococcus dysgalactiae subsp. equisimilis (str
Source: Streptococcus dysgalactiae subsp. equisimilis (str
6-138: IPR000064, the Endopeptidase, NLPC/P60 domain
154-192: IPR013168, the Cpl-7 lysozyme, C-terminal?
198-236: IPR013169, the Cpl-7 lysozyme, C-terminal?
270-399: IPR002901, the Mannosyl-glycoprotein endo-beta-N-acetylglucosamid
Molecular Function: 0004040, the amidase activity?
Linking to UniprotKB
Linging to InterPro
Domains and repeats
5-145: IPR008044, the Bacteriophage lysin6-138: IPR000064, the Endopeptidase, NLPC/P60 domain
154-192: IPR013168, the Cpl-7 lysozyme, C-terminal?
198-236: IPR013169, the Cpl-7 lysozyme, C-terminal?
270-399: IPR002901, the Mannosyl-glycoprotein endo-beta-N-acetylglucosamid
GO term prediction
Biological Process: 0009253, the peptidoglycan catabolic processMolecular Function: 0004040, the amidase activity?
Linking to UniprotKB
Linging to InterPro
Annotation
40-476
40-476
: EAD, Glycosidase domain, derived from Group B streptococcal prophage endolysin ??Sa2;Domain and repeats:
40-476
: IPR008044,Bacteriophage lysin; 41-469
: IPR000064,Endopeptidase, NLPC/P60 domain; GO term prediction:
VAEQSPAVKQDGDLLFNGAVLKKAILDKILAKCKEHDILPSYAITVLHFEGLWGTSAVGKADNNWGGMTWTGKGERPSGVTVTQGTARPASEGGNYMHYASVDDFLTDWFYLLSADGSYKVSGAKTFSEAVKGMFKVGGAVYDYAASGYDNYIVGMASRLKAIEQENGPLNKYDKQTDISVGQSDKIDVVIDSLEITINGVTYTSTKKPV