Detail of GM0053
Summary
The genetically modified enzybiotic, named LysgaYD36 , constructed by Truncation strategy, decrease the lytic activity.With LysgaYD36
Sequence Length: 36 AA.
Mass: 3831.2 Da.
Isoelectric Point: 7.54
Function: has no lytic activity
Construction
GM0053, constructed by Truncation strategy. No schema construted on GM0053
Details:
GM0053[1-36]: derive from protein Q65YV6 sequence 1-36
Q65YV6, 310 AA., the Lysin from Lactobacillus phage phigaY
Source: Lactobacillus phage phigaY
235-305: IPR003646, the SH3-like domain, bacterial-type
Biological Process: 0009253, the peptidoglycan catabolic proces
Biological Process: 0016998, the peptidoglycan catabolic proces
Molecular Function: 0003796, the lysozyme activity
Linking to UniprotKB
Linging to InterPro
Domains and repeats
4-209: IPR013781, the Glycoside hydrolase, catalytic domain235-305: IPR003646, the SH3-like domain, bacterial-type
GO term prediction
Biological Process: 0005975, the carbohydrate metabolic processBiological Process: 0009253, the peptidoglycan catabolic proces
Biological Process: 0016998, the peptidoglycan catabolic proces
Molecular Function: 0003796, the lysozyme activity
Linking to UniprotKB
Linging to InterPro
Annotation
1-36
1-206
: EAD, domain, derived from Lactobacillus gasseri JCM 1131T phage ??gaY endolysin,LysgaY;217-310
: CBD, SH3bgaY domain, derived from Lactobacillus gasseri JCM 1131T phage ??gaY endolysin,LysgaY;Domain and repeats:
GO term prediction:
MVEVAKRSYGVDVSSHNNGNYSGSKFAVVKVSEGLD
Production
1. Expressed by pUC120 in E. coli NovaBlue(DE11), Purified by His-bind kit (Novagen, Germany) and Sephacryl S-200 HRActivity
No activity data found on GM0053Reference
1. Sugahara, K.Yokoi, K. J.Nakamura, Y.Nishino, T.Yamakawa, A.Taketo, A.Kodaira, K.. (2007) Mutational and biochemical analyses of the endolysin Lys(gaY) encoded by the Lactobacillus gasseri JCM 1131T phage phi gaY. Gene. 00:41-52. [doi:10.1016/j.gene.2007.08.023] [PMID:17920212]2. Diaz, E.Lopez, R.Garcia, J. L.. (1991) Chimeric pneumococcal cell wall lytic enzymes reveal important physiological and evolutionary traits. Journal of biological chemistry. 09:5464-5471 [PMID:1672313]