Detail of GM0096
Summary
The genetically modified enzybiotic, named endo/ami , constructed by Truncation strategy, keep the lytic activity.With endo/ami
Sequence Length: 367 AA.
Mass: 41181.5 Da.
Isoelectric Point: 8.94
Function: Lytic activity of the phi11 endolysin on heat-killed staphylococ-cal cells was abolished while retained nearly all of its lytic activity on SDS cell walls
Construction
GM0096, constructed by Truncation strategy. No schema construted on GM0096
Details:
GM0096[1-370]: derive from protein Q8SDS7 sequence 1-370
Q8SDS7, 481 AA., the Amidase from Staphylococcus phage phi11 (Bacteriophage phi-11)
Source: Staphylococcus phage phi11 (Bacteriophage phi-11)
188-338: IPR002502, the N-acetylmuramoyl-L-alanine amidase domain
395-466: IPR003646, the SH3-like domain, bacterial-type
Molecular Function: 0008745, the N-acetylmuramoyl-L-alanine amidase activity?
Linking to UniprotKB
Linging to InterPro
Domains and repeats
7-148: IPR007921, the CHAP domain188-338: IPR002502, the N-acetylmuramoyl-L-alanine amidase domain
395-466: IPR003646, the SH3-like domain, bacterial-type
GO term prediction
Biological Process: 0009253, the peptidoglycan catabolic processMolecular Function: 0008745, the N-acetylmuramoyl-L-alanine amidase activity?
Linking to UniprotKB
Linging to InterPro
Annotation
1-370
7-148
: EAD, Endopeptidase domain, derived from S. aureus NCTC8325 bacteriophages ??11;188-338
: EAD, Amidase domain, derived from S. aureus NCTC8325 bacteriophages ??12;Domain and repeats:
188-338
: IPR002502,N-acetylmuramoyl-L-alanine amidase domain; 7-148
: IPR007921,CHAP domain; GO term prediction:
0008745, the N-acetylmuramoyl-L-alanine amidase activity
0009253, the peptidoglycan catabolic process
MQAKLTKNEFIEWLKTSEGKQFNVDLWYGFQCFDYANAGWKVLFGLLLKGLGAKDIPFANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAYDFPMWFIRPNFKSETAPRSVQSPTQAPKKETAKPQPKAVELKIIKDVVKGYDLPKRGSNPKGIVIHNDAGSKGATAEAYRNGLVNAPLSRLEAGIAHSYVSGNTVWQALDESQVGWHTANQIGNKYYYGIEVCQSMGADNATFLKNEQATFQECARLLKKWGLPANRNTIRLHNEFTSTSCPHRSSVLHTGFDPVTRGLLPEDKRLQLKDYFIKQIRAYMIPVATVS