Detail of GM0098
Summary
The genetically modified enzybiotic, named endo/CBD , constructed by Truncation strategy, decrease the lytic activity.With endo/CBD
Sequence Length: 300 AA.
Mass: 33840 Da.
Isoelectric Point: 6.78
Function: decrease the lytic activity
Construction
GM0098, constructed by Truncation strategy. No schema construted on GM0098
Details:
GM0098[1-180]: derive from protein Q8SDS7 sequence 1-180
Q8SDS7, 481 AA., the Amidase from Staphylococcus phage phi11 (Bacteriophage phi-11)
Source: Staphylococcus phage phi11 (Bacteriophage phi-11)
188-338: IPR002502, the N-acetylmuramoyl-L-alanine amidase domain
395-466: IPR003646, the SH3-like domain, bacterial-type
Molecular Function: 0008745, the N-acetylmuramoyl-L-alanine amidase activity?
Linking to UniprotKB
Linging to InterPro
Domains and repeats
7-148: IPR007921, the CHAP domain188-338: IPR002502, the N-acetylmuramoyl-L-alanine amidase domain
395-466: IPR003646, the SH3-like domain, bacterial-type
GO term prediction
Biological Process: 0009253, the peptidoglycan catabolic processMolecular Function: 0008745, the N-acetylmuramoyl-L-alanine amidase activity?
Linking to UniprotKB
Linging to InterPro
GM0098[181-300]: derive from protein Q8SDS7 sequence 362-481
Q8SDS7, 481 AA., the Amidase from Staphylococcus phage phi11 (Bacteriophage phi-11)
Source: Staphylococcus phage phi11 (Bacteriophage phi-11)
188-338: IPR002502, the N-acetylmuramoyl-L-alanine amidase domain
395-466: IPR003646, the SH3-like domain, bacterial-type
Molecular Function: 0008745, the N-acetylmuramoyl-L-alanine amidase activity?
Linking to UniprotKB
Linging to InterPro
Domains and repeats
7-148: IPR007921, the CHAP domain188-338: IPR002502, the N-acetylmuramoyl-L-alanine amidase domain
395-466: IPR003646, the SH3-like domain, bacterial-type
GO term prediction
Biological Process: 0009253, the peptidoglycan catabolic processMolecular Function: 0008745, the N-acetylmuramoyl-L-alanine amidase activity?
Linking to UniprotKB
Linging to InterPro
Annotation
1-180
181-300
1-180
: EAD, Endopeptidase domain, derived from S. aureus NCTC8325 bacteriophages ??14;181-300
: CBD, SH3b domain, derived from S. aureus NCTC8325 bacteriophages ??15;Domain and repeats:
214-285
: IPR003646,SH3-like domain, bacterial-type; 7-148
: IPR007921,CHAP domain; GO term prediction:
MQAKLTKNEFIEWLKTSEGKQFNVDLWYGFQCFDYANAGWKVLFGLLLKGLGAKDIPFANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLDYIIVYEQNWLGGGWTDGIEQPGWGWEKVTRRQHAYDFPMWFIRPNFKSETAPRSVQSPTQAPKKETAKPQPKAVEGKIPVATVSNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPVGYQFQPGGYCDYTEVMLQDGHVWVGYTWEGQRYYLPIRTWNGSAPPNQILGDLWGEIS