Detail of GM0117
Summary
The genetically modified enzybiotic, named PlyGBS94(1-146) , constructed by Truncation strategy, improve the lytic activity.With PlyGBS94(1-146)
Sequence Length: 146 AA.
Mass: 16085.7 Da.
Isoelectric Point: 4.43
Function: has a ∼25-fold higher specific activity than wild-type PlyGBS
Construction
GM0117, constructed by Truncation strategy. No schema construted on GM0117
Details:
GM0117[1-146]: derive from protein Q5MY96 sequence 1-146
Q5MY96, 443 AA., the Lysin PlyGBS from Streptococcus phage NCTC11261
Source: Streptococcus phage NCTC11261
152 - 339: IPR017853, the Glycoside hydrolase, superfamily
390 - 437: IPR003646, the SH3-like domain, bacterial-type
Biological Process: 0009253, the peptidoglycan catabolic process
Biological Process: 0016998, the cell wall macromolecule catabolic process
Molecular Function: 0003796, the lysozyme activity
Linking to UniprotKB
Linging to InterPro
Domains and repeats
1 - 131: IPR007921, the CHAP domain152 - 339: IPR017853, the Glycoside hydrolase, superfamily
390 - 437: IPR003646, the SH3-like domain, bacterial-type
GO term prediction
Biological Process: 0005975, the carbohydrate metabolic processBiological Process: 0009253, the peptidoglycan catabolic process
Biological Process: 0016998, the cell wall macromolecule catabolic process
Molecular Function: 0003796, the lysozyme activity
Linking to UniprotKB
Linging to InterPro
Annotation
1-146
1-46
: EAD, Endopeptidase domain, derived from group B streptococci bacteriophage lytic enzyme PlyGBS;Domain and repeats:
1-146
: IPR003646,SH3-like domain, bacterial-type; 1-146
: IPR007921,CHAP domain; 1-146
: IPR017853,Glycoside hydrolase, superfamily; GO term prediction:
MATYQEYKSRSNGNAYDIDGSFGAQCWDGYADYCKYLGLPYANCTNTGYARDIWEQRHENGILNYFDEVEVMQAGDVAIFMVVDGVTPYSHVAIFDSDAGGGYGWFLGQNQGGANGAYNIVKIPYSATYPTAFRPKVFKNAVTVTG