Detail of GM0121
Summary
The genetically modified enzybiotic, named PlyGBS93(150-443) , constructed by Truncation strategy, decrease the lytic activity.With PlyGBS93(150-443)
Sequence Length: 294 AA.
Mass: 33258.8 Da.
Isoelectric Point: 4.78
Function: has no lytic activity
Construction
GM0121, constructed by Truncation strategy. No schema construted on GM0121
Details:
GM0121[1-294]: derive from protein Q5MY96 sequence 150-443
Q5MY96, 443 AA., the Lysin PlyGBS from Streptococcus phage NCTC11261
Source: Streptococcus phage NCTC11261
152 - 339: IPR017853, the Glycoside hydrolase, superfamily
390 - 437: IPR003646, the SH3-like domain, bacterial-type
Biological Process: 0009253, the peptidoglycan catabolic process
Biological Process: 0016998, the cell wall macromolecule catabolic process
Molecular Function: 0003796, the lysozyme activity
Linking to UniprotKB
Linging to InterPro
Domains and repeats
1 - 131: IPR007921, the CHAP domain152 - 339: IPR017853, the Glycoside hydrolase, superfamily
390 - 437: IPR003646, the SH3-like domain, bacterial-type
GO term prediction
Biological Process: 0005975, the carbohydrate metabolic processBiological Process: 0009253, the peptidoglycan catabolic process
Biological Process: 0016998, the cell wall macromolecule catabolic process
Molecular Function: 0003796, the lysozyme activity
Linking to UniprotKB
Linging to InterPro
Annotation
1-294
1-294
: EAD, Amidase domain, derived from group B streptococci bacteriophage lytic enzyme PlyGBS;Domain and repeats:
1-294
: IPR003646,SH3-like domain, bacterial-type; 1-294
: IPR007921,CHAP domain; 1-294
: IPR017853,Glycoside hydrolase, superfamily; GO term prediction:
LNKGDYFIDVSAYQQADLTTTCQQAGTTKTIIKVSESIAWLSDRHQQQANTSDPIGYYHFGRFGGDSALAQREADLFLSNLPSKKVSYLVIDYEDSASADKQANTNAVIAFMDKIASAGYKPIYYSYKPFTLNNIDYQKIIAKYPNSIWIAGYPDYEVRTEPLWEFFPSMDGVRWWQFTSVGVAGGLDKNIVLLADDSSKMDIPKVDKPQELTFYQKLATNTKLDNSNVPYYEATLSTDYYVESKPNASSADKEFIKAGTRVRVYEKVNGWSRINHPESAQWVEDSYLVNATDM