Detail of GM0145
Summary
The genetically modified enzybiotic, named D7 , constructed by Truncation strategy, decrease the lytic activity.With D7
Sequence Length: 98 AA.
Mass: 10799.1 Da.
Isoelectric Point: 8.97
Function: decrease the lytic activity
Construction
GM0145, constructed by Truncation strategy. No schema construted on GM0145
Details:
GM0145[1-98]: derive from protein P11187 sequence 46-143
P11187, 258 AA., the Lysozyme EC=3.2.1.17 from Bacillus phage phi29
Source: Bacillus phage phi29
162 - 207: IPR018392, the LysM domain
213 - 258: IPR018392, the LysM domain
Biological Process: 0016998, the cell wall macromolecule catabolic process
Molecular Function: 0003796, the Lysozyme activity
Linking to UniprotKB
Linging to InterPro
Domains and repeats
1 - 147: IPR023346, the Lysozyme-like domain162 - 207: IPR018392, the LysM domain
213 - 258: IPR018392, the LysM domain
GO term prediction
Biological Process: 0009253, the peptidoglycan catabolic processBiological Process: 0016998, the cell wall macromolecule catabolic process
Molecular Function: 0003796, the Lysozyme activity
Linking to UniprotKB
Linging to InterPro
Annotation
1-98
1-98
: EAD, Endopeptidase domain, derived from Bacillus amyloliquefaciens phage endolysin;Domain and repeats:
1-98
: IPR018392,LysM domain; 1-98
: IPR018392,LysM domain ; 1-98
: IPR023346,Lysozyme-like domain; GO term prediction:
QVITAKQAEDMLRDDVQAFVDGVNKALKVSVTQNQFDALVSFAYNVGLGAFRSSSLLEYLNEGRTALAAAEFPKWNKSGGKVYQGLINRRAQEQALFN