Detail of GM0152


Summary

The genetically modified enzybiotic, named LCA , constructed by Domains Assembly strategy, change or extend lytic spectrum.
With  LCA
  Sequence Length:  315 AA.
  Mass:  36242 Da.
  Isoelectric Point:  5.07
  Function:  LCA exhibited amidase activities at levels similar to LYTA and switched the regulatory properties to CPL1.

Construction

GM0152, constructed by Domains Assembly strategy.
Q8KLP2: N-acetylmuramoyl-L-alanine amidase
P15057: Lysozyme EC=3.2.1.17
UniProt

IPR002502:10 - 151
IPR018337:175 - 194
IPR018337:196 - 215
IPR018337:217 - 237
IPR018337:238 - 257
IPR018337:258 - 277
IPR018337:280 - 301
IPR017853:3-185
IPR018337:220-239
IPR018337:241-260
IPR018337:261-280
IPR018337:281-301
IPR018337:303-322
InterPro

GM0152:1-187
GM0152:188-316
GMEnzy

30
60
90
120
150
180
210
240
270
300
318
30
60
90
120
150
180
210
240
270
300
330
339

Details:
GM0152[1-187]: derive from protein Q8KLP2 sequence 1-187

Q8KLP2, 318 AA., the N-acetylmuramoyl-L-alanine amidase from Streptococcus pneumoniae

Source: Streptococcus pneumoniae

Domains and repeats

10 - 151:  IPR002502, the N-acetylmuramoyl-L-alanine amidase domain
175 - 194:  IPR018337, the Cell wall/choline-binding repeat
196 - 215:  IPR018337, the Cell wall/choline-binding repeat
217 - 237:  IPR018337, the Cell wall/choline-binding repeat
238 - 257:  IPR018337, the Cell wall/choline-binding repeat
258 - 277:  IPR018337, the Cell wall/choline-binding repeat
280 - 301:  IPR018337, the Cell wall/choline-binding repeat

GO term prediction

Biological Process:  0009253, the peptidoglycan catabolic process?
Molecular Function:  0008745, the N-acetylmuramoyl-L-alanine amidase activity?


Linking to UniprotKB
Linging to InterPro
GM0152[188-316]: derive from protein P15057 sequence 212-339

P15057, 339 AA., the Lysozyme EC=3.2.1.17 from Streptococcus phage Cp-1

Source: Streptococcus phage Cp-1

Domains and repeats

3-185:  IPR017853, the Glycoside hydrolase, catalytic domain?
220-239:  IPR018337, the Cell wall/choline-binding repeat
241-260:  IPR018337, the Cell wall/choline-binding repeat
261-280:  IPR018337, the Cell wall/choline-binding repeat
281-301:  IPR018337, the Cell wall/choline-binding repeat
303-322:  IPR018337, the Cell wall/choline-binding repeat

GO term prediction

Biological Process:  0005975, the carbohydrate metabolic process
Biological Process:  0009253, the peptidoglycan catabolic process
Biological Process:  0016998, the cell wall macromolecule catabolic process
Molecular Function:  0003796, the lysozyme activity


Linking to UniprotKB
Linging to InterPro
MEINVSKLRTDLPQVGVQPYRQVHAHSTGNPHSTVQNEADYHWRKDPELGFFSHIVGNGCIMQVGPVDNGAWDVGGGWNAETYAAVELIESHSTKEEFMTDYRLYIELLRNLADEAGLPKTLDTGSLAGIKTHEYCTNNQPNNHSDHVDPYPYLAKWGISREQFKHDIENGLTIETGWQKNDTGYWY-RRNNGSFPYNKWEKIGGVWYYFDSKGYCLTSEWLKDNEKWYYLKDNGAMATGWVLVGSEWYYMDDSGAMVTGWVKYKNNWYYMTNERGNMVSNEFIKSGKGWYFMNTNGELADNPSFTKEPDGLITVA
  BlastP to GMEnzy

Production

  1.  Expressed by pCL in E. coli HB101,  Purified by affinity chromatography on DEAE-cellulose

Activity

  1.  Enzymatic activity test on (Amidase) by
  showed 180,000 unit/mg protein

Reference

  1. Lopez, R.Garcia, E.Garcia, P.Garcia, J. L.. (1997) The pneumococcal cell wall degrading enzymes: a modular design to create new lysins?. Microbial drug resistance. 02:199-211. [doi:10.1089/mdr.1997.3.199] [PMID:9185148]
  2. Diaz, E.Lopez, R.Garcia, J. L.. (1990) Chimeric phage-bacterial enzymes: a clue to the modular evolution of genes. Proceedings of the National Academy of Sciences of. 020:8125-8129. [doi:10.1073/pnas.87.20.8125] [PMID:1978320] [FULL TEXT]

Comments

    No comments found on GM0152


CAPTCHA Image   Reload Image
Enter Code*: