Detail of GM0155


Summary

The genetically modified enzybiotic, named Tsl , constructed by Domains Assembly strategy, change or extend lytic spectrum.
With  Tsl
  Sequence Length:  317 AA.
  Mass:  35845.1 Da.
  Isoelectric Point:  9.22
  Function:  Tsl exhibited a glycosidase activity capable of hydrolysing choline-containing pneumococcal cell wails.

Construction

GM0155, constructed by Domains Assembly strategy.
Q38614: Lysin
Q8KLP2: N-acetylmuramoyl-L-alanine amidase
UniProt

IPR017853:26 - 229
IPR018392:331 - 375
IPR018392:385 - 427
IPR002502:10 - 151
IPR018337:175 - 194
IPR018337:196 - 215
IPR018337:217 - 237
IPR018337:238 - 257
IPR018337:258 - 277
IPR018337:280 - 301
InterPro

GM0155:1-186
GM0155:187-317
GMEnzy

30
60
90
120
150
180
210
240
270
300
330
360
390
420
428
30
60
90
120
150
180
210
240
270
300
318

Details:
GM0155[1-186]: derive from protein Q38614 sequence 1-186

Q38614, 428 AA., the Lysin from Lactococcus phage Tuc2009

Source: Lactococcus phage Tuc2009

Domains and repeats

26 - 229:  IPR017853, the Glycoside hydrolase, superfamily
331 - 375:  IPR018392, the LysM domain
385 - 427:  IPR018392, the LysM domain

GO term prediction

Biological Process:  0005975, the carbohydrate metabolic process?
Biological Process:  0009253, the peptidoglycan catabolic process
Biological Process:  0016998, the cell wall macromolecule catabolic process
Molecular Function:  0003796, the lysozyme activity?


Linking to UniprotKB
Linging to InterPro
GM0155[187-317]: derive from protein Q8KLP2 sequence 188-318

Q8KLP2, 318 AA., the N-acetylmuramoyl-L-alanine amidase from Streptococcus pneumoniae

Source: Streptococcus pneumoniae

Domains and repeats

10 - 151:  IPR002502, the N-acetylmuramoyl-L-alanine amidase domain
175 - 194:  IPR018337, the Cell wall/choline-binding repeat
196 - 215:  IPR018337, the Cell wall/choline-binding repeat
217 - 237:  IPR018337, the Cell wall/choline-binding repeat
238 - 257:  IPR018337, the Cell wall/choline-binding repeat
258 - 277:  IPR018337, the Cell wall/choline-binding repeat
280 - 301:  IPR018337, the Cell wall/choline-binding repeat

GO term prediction

Biological Process:  0009253, the peptidoglycan catabolic process?
Molecular Function:  0008745, the N-acetylmuramoyl-L-alanine amidase activity?


Linking to UniprotKB
Linging to InterPro

Annotation

1-186
187-317
50
100
150
200
250
300
350
400
450
500
550
600
650
700
746

1-186
: EAD, Lysozyme domain, derived from Lactococcus lactis phage Tuc2009;
187-317
: CBD, cell wall-targeting domain, derived from S. pneumoniae 101 LytAlOl amidase;
Domain and repeats:
1-186
: IPR017853,Glycoside hydrolase, superfamily;
1-186
: IPR018392,LysM domain ;
1-186
: IPR018392,LysM domain ;
187-317
: IPR018337,Cell wall/choline-binding repeat;
187-317
: IPR018337,Cell wall/choline-binding repeat;
187-317
: IPR002502,N-acetylmuramoyl-L-alanine amidase domain;
187-317
: IPR018337,Cell wall/choline-binding repeat;
187-317
: IPR018337,Cell wall/choline-binding repeat;
187-317
: IPR018337,Cell wall/choline-binding repeat;
187-317
: IPR018337,Cell wall/choline-binding repeat;
GO term prediction:
0008745, the N-acetylmuramoyl-L-alanine amidase activity
0009253, the peptidoglycan catabolic process
MKRLIKKSAIGMFAFFVVAASGPVFAASGDQGVDWPKYNGTYGNFGYAHDKFAFSQIGGTYGGTFVDQATYKTQVASAIAQGKRAHTYIWYQVGGSQEVAKAALDRYLPKIQTPKNSIVALDYESGASGDKQANTDAILYGMRRVKAAGYTPMYYSYKPYTLANVNYKQIIKEFPNSLWIAAYPNY-VHSDGSYPKDKFEKINGTWYYFDSSGYMLADRWRKHTDGNWYWFDNSGEMATGWKKIADKWYYFNEEGAMKTGWVKYKDTWYYLDAKEGAMVSNAFIQSADGTGWYYLKPDGTLADKPEFTVEPDGLITVK
  BlastP to GMEnzy

Production

  1.  Expressed by pMSJ1 in E. coli DH5Alpha,  Purified by affinity chromatography in DEAE-cellulose

Activity

    No activity data found on GM0155

Reference

  1. Lopez, R.Garcia, E.Garcia, P.Garcia, J. L.. (1997) The pneumococcal cell wall degrading enzymes: a modular design to create new lysins?. Microbial drug resistance. 02:199-211. [doi:10.1089/mdr.1997.3.199] [PMID:9185148]
  2. Sheehan, M. M.Garcia, J. L.Lopez, R.Garcia, P.. (1996) Analysis of the catalytic domain of the lysin of the lactococcal bacteriophage Tuc2009 by chimeric gene assembling. FEMS microbiology letters. 01:23-28. [doi:10.1111/j.1574-6968.1996.tb08309.x] [PMID:8666197]

Comments

    No comments found on GM0155


CAPTCHA Image   Reload Image
Enter Code*: