Detail of GM0156


Summary

The genetically modified enzybiotic, named LCL , constructed by Domains Assembly strategy, improve the lytic activity.
With  LCL
  Sequence Length:  309 AA.
  Mass:  33911.3 Da.
  Isoelectric Point:  4.68
  Function:  LCL exhibited an amidase activity capable of hydrolyzing choline-containing clostridial cell walls with an efficiency 250-times higher than when tested on pneumococcal cell walls.

Construction

GM0156, constructed by Domains Assembly strategy.
P06653: Autolysin EC=3.5.1.28
P34020: Autolytic lysozyme EC=3.2.1.17
UniProt

IPR002502:10 - 170
IPR018337:175 - 194
IPR018337:196 - 215
IPR018337:217 - 237
IPR018337:238 - 257
IPR018337:258 - 277
IPR018337:280 - 301
IPR017853:1 - 181
IPR002477:190 - 252
IPR002477:277 - 320
InterPro

GM0156:1-178
GM0156:179-309
GMEnzy

30
60
90
120
150
180
210
240
270
300
318
30
60
90
120
150
180
210
240
270
300
324

Details:
GM0156[1-178]: derive from protein P06653 sequence 1-178

P06653, 318 AA., the Autolysin EC=3.5.1.28 from Streptococcus pneumoniae serotype 4 (strain ATCC B

Source: Streptococcus pneumoniae serotype 4 (strain ATCC B

Domains and repeats

10 - 170:  IPR002502, the N-acetylmuramoyl-L-alanine amidase domain
175 - 194:  IPR018337, the Cell wall/choline-binding repeat
196 - 215:  IPR018337, the Cell wall/choline-binding repeat
217 - 237:  IPR018337, the Cell wall/choline-binding repeat
238 - 257:  IPR018337, the Cell wall/choline-binding repeat
258 - 277:  IPR018337, the Cell wall/choline-binding repeat
280 - 301:  IPR018337, the Cell wall/choline-binding repeat

GO term prediction

Biological Process:  0009253, the peptidoglycan catabolic process
Molecular Function:  0008745, the N-acetylmuramoyl-L-alanine amidase activity


Linking to UniprotKB
Linging to InterPro
GM0156[179-309]: derive from protein P34020 sequence 194-324

P34020, 324 AA., the Autolytic lysozyme EC=3.2.1.17 from Clostridium acetobutylicum (strain ATCC 824 / DSM

Source: Clostridium acetobutylicum (strain ATCC 824 / DSM

Domains and repeats

1 - 181:  IPR017853, the Glycoside hydrolase, superfamily
190 - 252:  IPR002477, the Peptidoglycan binding-like
277 - 320:  IPR002477, the Peptidoglycan binding-like

GO term prediction

Biological Process:  0005975, the carbohydrate metabolic process?
Biological Process:  0009253, the peptidoglycan catabolic process?
Biological Process:  0016998, the cell wall macromolecule catabolic process?
Molecular Function:  0003796, the lysozyme activity?


Linking to UniprotKB
Linging to InterPro
MEINVSKLRTDLPQVGVQPYRQVHAHSTGNPHSTVQNEADYHWRKDPELGFFSHIVGNGCIMQVGPVDNGAWDVGGGWNAETYAAVELIESHSTKEEFMTDYRLYIELLRNLADEAGLPKTLDTGSLAGIKTHEYCTNNQPNNHSDHVDPYPYLAKWGISREQFKHDIENGLTIETGTPGQGGDDNIKAIQQDLNILLKRGLEVDGIEGPETEAAIKDFQSIMGLTVDGIWGTNTSGAAQQIFSRPLDGVAYPHYEYATRYIQYRVGASVDGTFGSGTKAKVAAWQSNQGLMADGVVGSATWSKLLDEN
  BlastP to GMEnzy

Production

  1.  Expressed by pLCL43 in E. coli MC4100,  Purified by Sephadex G-75 column

Activity

    No activity data found on GM0156

Reference

  1. Croux, C.Ronda, C.Lopez, R.Garcia, J. L.. (1993) Role of the C-terminal domain of the lysozyme of Clostridium acetobutylicum ATCC 824 in a chimeric pneumococcal-clostridial cell wall lytic enzyme. FEMS microbiology letters. 01:111-114. [doi:10.1016/0014-5793(93)81621-6] [PMID:7903254]

Comments

    No comments found on GM0156


CAPTCHA Image   Reload Image
Enter Code*: