Detail of GM0156
Summary
The genetically modified enzybiotic, named LCL , constructed by Domains Assembly strategy, improve the lytic activity.With LCL
Sequence Length: 309 AA.
Mass: 33911.3 Da.
Isoelectric Point: 4.68
Function: LCL exhibited an amidase activity capable of hydrolyzing choline-containing clostridial cell walls with an efficiency 250-times higher than when tested on pneumococcal cell walls.
Construction
GM0156, constructed by Domains Assembly strategy. No schema construted on GM0156
Details:
GM0156[1-178]: derive from protein P06653 sequence 1-178
P06653, 318 AA., the Autolysin EC=3.5.1.28 from Streptococcus pneumoniae serotype 4 (strain ATCC B
Source: Streptococcus pneumoniae serotype 4 (strain ATCC B
175 - 194: IPR018337, the Cell wall/choline-binding repeat
196 - 215: IPR018337, the Cell wall/choline-binding repeat
217 - 237: IPR018337, the Cell wall/choline-binding repeat
238 - 257: IPR018337, the Cell wall/choline-binding repeat
258 - 277: IPR018337, the Cell wall/choline-binding repeat
280 - 301: IPR018337, the Cell wall/choline-binding repeat
Molecular Function: 0008745, the N-acetylmuramoyl-L-alanine amidase activity
Linking to UniprotKB
Linging to InterPro
Domains and repeats
10 - 170: IPR002502, the N-acetylmuramoyl-L-alanine amidase domain175 - 194: IPR018337, the Cell wall/choline-binding repeat
196 - 215: IPR018337, the Cell wall/choline-binding repeat
217 - 237: IPR018337, the Cell wall/choline-binding repeat
238 - 257: IPR018337, the Cell wall/choline-binding repeat
258 - 277: IPR018337, the Cell wall/choline-binding repeat
280 - 301: IPR018337, the Cell wall/choline-binding repeat
GO term prediction
Biological Process: 0009253, the peptidoglycan catabolic processMolecular Function: 0008745, the N-acetylmuramoyl-L-alanine amidase activity
Linking to UniprotKB
Linging to InterPro
GM0156[179-309]: derive from protein P34020 sequence 194-324
P34020, 324 AA., the Autolytic lysozyme EC=3.2.1.17 from Clostridium acetobutylicum (strain ATCC 824 / DSM
Source: Clostridium acetobutylicum (strain ATCC 824 / DSM
190 - 252: IPR002477, the Peptidoglycan binding-like
277 - 320: IPR002477, the Peptidoglycan binding-like
Biological Process: 0009253, the peptidoglycan catabolic process?
Biological Process: 0016998, the cell wall macromolecule catabolic process?
Molecular Function: 0003796, the lysozyme activity?
Linking to UniprotKB
Linging to InterPro
Domains and repeats
1 - 181: IPR017853, the Glycoside hydrolase, superfamily190 - 252: IPR002477, the Peptidoglycan binding-like
277 - 320: IPR002477, the Peptidoglycan binding-like
GO term prediction
Biological Process: 0005975, the carbohydrate metabolic process?Biological Process: 0009253, the peptidoglycan catabolic process?
Biological Process: 0016998, the cell wall macromolecule catabolic process?
Molecular Function: 0003796, the lysozyme activity?
Linking to UniprotKB
Linging to InterPro
Annotation
1-178
179-309
1-178
: EAD, amidase domain, derived from pneumococcal LYTA amidase;179-309
: CBD, choline-binding domain, derived from clostridial LYC lysozyme;Domain and repeats:
1-178
: IPR018337,Cell wall/choline-binding repeat ; 1-178
: IPR018337,Cell wall/choline-binding repeat ; 1-178
: IPR018337,Cell wall/choline-binding repeat ; 1-178
: IPR018337,Cell wall/choline-binding repeat ; 1-178
: IPR018337,Cell wall/choline-binding repeat ; 1-178
: IPR002502,N-acetylmuramoyl-L-alanine amidase domain; 1-178
: IPR018337,Cell wall/choline-binding repeat ; 179-309
: IPR002477,Peptidoglycan binding-like; 179-309
: IPR017853,Glycoside hydrolase, superfamily; 179-309
: IPR002477,Peptidoglycan binding-like; GO term prediction:
0008745, the N-acetylmuramoyl-L-alanine amidase activity
0009253, the peptidoglycan catabolic process
MEINVSKLRTDLPQVGVQPYRQVHAHSTGNPHSTVQNEADYHWRKDPELGFFSHIVGNGCIMQVGPVDNGAWDVGGGWNAETYAAVELIESHSTKEEFMTDYRLYIELLRNLADEAGLPKTLDTGSLAGIKTHEYCTNNQPNNHSDHVDPYPYLAKWGISREQFKHDIENGLTIETGTPGQGGDDNIKAIQQDLNILLKRGLEVDGIEGPETEAAIKDFQSIMGLTVDGIWGTNTSGAAQQIFSRPLDGVAYPHYEYATRYIQYRVGASVDGTFGSGTKAKVAAWQSNQGLMADGVVGSATWSKLLDEN