Detail of GM0159


Summary

The genetically modified enzybiotic, named C162 , constructed by Truncation strategy, improve the lytic activity.
With  C162
  Sequence Length:  162 AA.
  Mass:  18288.4 Da.
  Isoelectric Point:  8.81
  Function:  Zymogram activity show zone of clearing

Construction

GM0159, constructed by Truncation strategy.
I6X5A8: LysK
UniProt

IPR007921:29-160
IPR002502:196-369
IPR003646:409-481
InterPro

GM0159:1-162
GMEnzy

30
60
90
120
150
180
210
240
270
300
330
360
390
420
450
480
495

Details:
GM0159[1-162]: derive from protein I6X5A8 sequence 1-162

I6X5A8, 495 AA., the LysK from Staphylococcus phage Fi200W

Source: Staphylococcus phage Fi200W

Domains and repeats

29-160:  IPR007921, the CHAP domain
196-369:  IPR002502, the N-acetylmuramoyl-L-alanine amidase domain
409-481:  IPR003646, the SH3-like domain, bacterial-type?

GO term prediction

Molecular Function:  0008745, the N-acetylmuramoyl-L-alanine amidase activity


Linking to UniprotKB
Linging to InterPro

Annotation

1-162
50
100
150
200
250
300
350
400
450
495

35-160
: EAD, CHAP domain, derived from phage endolysin LysK;
35-160
: EAD, CHAP domain, derived from phage endolysin LysK;
Domain and repeats:
29-160
: IPR007921,CHAP domain;
GO term prediction:
MAKTQAEINKRLDAYAKGTVDSPYRVKKATSYDPSFGVMEAGAIDADGYYHAQCQDLITDYVLWLTDNKVRTWGNAKDQIKQSYGTGFKIHENKPSTVPKKGWIAVFTSGSYEQWGHIGIVYDGGNTSTFTILEQNWNGYANKKPTKRVDNYYGLTHFIEIP
  BlastP to GMEnzy

Production

  1.  Expressed by pQE60 in E. coli XL1-Blue,  Purified by ion-exchange and size exclusion chromatography

Activity

    No activity data found on GM0159

Reference

  1. Yokoi, K. J.Kawahigashi, N.Uchida, M.Sugahara, K.Shinohara, M.Kawasaki, K.Nakamura, S.Taketo, A.Koda. (2005) The two-component cell lysis genes holWMY and lysWMY of the Staphylococcus warneri M phage varphiWMY: cloning, sequencing, expression, and mutational analysis in Escherichia coli. Gene. 00:97-108. [doi:10.1016/j.gene.2005.03.006] [PMID:15848115]

Comments

    No comments found on GM0159


CAPTCHA Image   Reload Image
Enter Code*: