Detail of GM0164


Summary

The genetically modified enzybiotic, named ClyH , constructed by Domains Assembly strategy, improve the lytic activity.
With  ClyH
  Sequence Length:  253 AA.
  Mass:  28817.4 Da.
  Isoelectric Point:  9.87
  Function:  ClyH could kill all the tested clinical isolates of MRSA with higher efficacy than lysostaphin as well as its parental enzyme. The MICs of ClyH against clinical S.aureus were found as low as 0.05 to 1.61 mg/L.

Construction

GM0164, constructed by Domains Assembly strategy.
    No schema construted on GM0164
Details:
GM0164[1-157]: derive from protein O56785 sequence 1-157

O56785, 628 AA., the Cell wall hydrolase Ply187 from Staphylococcus phage 187?

Source: Staphylococcus phage 187?

Domains and repeats

11-145:  IPR007921, the CHAP domain
476-622:  IPR013338, the Lysozyme domain, subfamily 2
14-145:  IPR007921, the CHAP domain
476-622:  IPR013338, the Lysozyme domain, subfamily 2

GO term prediction

Biological Process:  0009253, the peptidoglycan catabolic process
Biological Process:  0044036, the cell wall macromolecule metabolic process
Molecular Function:  0004040, the amidase activity?
Molecular Function:  0016787, the hydrolase activity?
Biological Process:  0009253, the peptidoglycan catabolic process
Biological Process:  0044036, the cell wall macromolecule metabolic process?
Molecular Function:  0004040, the amidase activity?
Molecular Function:  0016787, the hydrolase activity?


Linking to UniprotKB
Linging to InterPro
GM0164[158-253]: derive from protein A0EX11 sequence 155-251

A0EX11, 251 AA., the Amidase from Staphylococcus phage phiNM3?

Source: Staphylococcus phage phiNM3?

Domains and repeats

4-133:  IPR007921, the CHAP domain

GO term prediction

    No GO info found on GM0164

Linking to UniprotKB
Linging to InterPro

Annotation

1-157
158-253

1-157
: EAD, Amidase domain, derived from Ply187;
188-284
: CBD, non-SH3b CBD domain, derived from phiNM3;
Domain and repeats:
11-145
: IPR007921,CHAP domain;
14-145
: IPR007921,CHAP domain;
GO term prediction:
MALPKTGKPTAKQVVDWAINLIGSGVDVDGYYGRQCWDLPNYIFNRYWNFKTPGNARDMAWYRYPEGFKVFRNTSDFVPKPGDIAVWTGGNYNWNTWGHTGIVVGPSTKSYFYSVDQWNNSNSYVGSPAAKIKHSYFGVTHFVRPAYKAEPKPTPP-KAVGKSASKITVGSKAPYNLKWSKGAYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDGWCRIYWNNHNEWIWHERLIVKEVF
  BlastP to GMEnzy

Production

  1.  Expressed by pBAD24 in E. coli BL21(DE3),  Purified by HiTrap Q Sepharose FF column (GE Healthcare), then bound to a HiTrap SP Sepharose FF column (GE Healthcare)

Activity

    No activity data found on GM0164

Reference

  1. Yang H, Zhang Y, Yu J, Huang Y, Zhang XE. (2013) A novel chimeric lysin with high antimicrobial activity against methicillin-resistant Staphylococcus aureus in vitro and in vivo.. Antimicrob Agents Chemother. :. [doi:10.1128/AAC.01793-13.] [PMID:24189265] [FULL TEXT]

Comments

    No comments found on GM0164


CAPTCHA Image   Reload Image
Enter Code*: