Detail of GM0165
Summary
The genetically modified enzybiotic, named PcH , constructed by Truncation strategy, improve the lytic activity.With PcH
Sequence Length: 159 AA.
Mass: 18139.3 Da.
Isoelectric Point: 9.81
Function:
Construction
GM0165, constructed by Truncation strategy. No schema construted on GM0165
Details:
GM0165[1-157]: derive from protein O56785 sequence 1-157
O56785, 628 AA., the Cell wall hydrolase Ply187 from Staphylococcus phage 187?
Source: Staphylococcus phage 187?
476-622: IPR013338, the Lysozyme domain, subfamily 2
14-145: IPR007921, the CHAP domain
476-622: IPR013338, the Lysozyme domain, subfamily 2
Biological Process: 0044036, the cell wall macromolecule metabolic process
Molecular Function: 0004040, the amidase activity?
Molecular Function: 0016787, the hydrolase activity?
Biological Process: 0009253, the peptidoglycan catabolic process
Biological Process: 0044036, the cell wall macromolecule metabolic process?
Molecular Function: 0004040, the amidase activity?
Molecular Function: 0016787, the hydrolase activity?
Linking to UniprotKB
Linging to InterPro
Domains and repeats
11-145: IPR007921, the CHAP domain476-622: IPR013338, the Lysozyme domain, subfamily 2
14-145: IPR007921, the CHAP domain
476-622: IPR013338, the Lysozyme domain, subfamily 2
GO term prediction
Biological Process: 0009253, the peptidoglycan catabolic processBiological Process: 0044036, the cell wall macromolecule metabolic process
Molecular Function: 0004040, the amidase activity?
Molecular Function: 0016787, the hydrolase activity?
Biological Process: 0009253, the peptidoglycan catabolic process
Biological Process: 0044036, the cell wall macromolecule metabolic process?
Molecular Function: 0004040, the amidase activity?
Molecular Function: 0016787, the hydrolase activity?
Linking to UniprotKB
Linging to InterPro
Annotation
1-157
1-157
: EAD, Amidase domain, derived from Ply187;Domain and repeats:
11-145
: IPR007921,CHAP domain; 14-145
: IPR007921,CHAP domain; GO term prediction:
MALPKTGKPTAKQVVDWAINLIGSGVDVDGYYGRQCWDLPNYIFNRYWNFKTPGNARDMAWYRYPEGFKVFRNTSDFVPKPGDIAVWTGGNYNWNTWGHTGIVVGPSTKSYFYSVDQWNNSNSYVGSPAAKIKHSYFGVTHFVRPAYKAEPKPTPPHHH