Detail of GM0165


Summary

The genetically modified enzybiotic, named PcH , constructed by Truncation strategy, improve the lytic activity.
With  PcH
  Sequence Length:  159 AA.
  Mass:  18139.3 Da.
  Isoelectric Point:  9.81
  Function:  

Construction

GM0165, constructed by Truncation strategy.
O56785: Cell wall hydrolase Ply187
UniProt

IPR007921:11-145
IPR007921:14-145
IPR013338:476-622
IPR013338:476-622
InterPro

GM0165:1-157
GMEnzy

30
60
90
120
150
180
210
240
270
300
330
360
390
420
450
480
510
540
570
600
628

Details:
GM0165[1-157]: derive from protein O56785 sequence 1-157

O56785, 628 AA., the Cell wall hydrolase Ply187 from Staphylococcus phage 187?

Source: Staphylococcus phage 187?

Domains and repeats

11-145:  IPR007921, the CHAP domain
476-622:  IPR013338, the Lysozyme domain, subfamily 2
14-145:  IPR007921, the CHAP domain
476-622:  IPR013338, the Lysozyme domain, subfamily 2

GO term prediction

Biological Process:  0009253, the peptidoglycan catabolic process
Biological Process:  0044036, the cell wall macromolecule metabolic process
Molecular Function:  0004040, the amidase activity?
Molecular Function:  0016787, the hydrolase activity?
Biological Process:  0009253, the peptidoglycan catabolic process
Biological Process:  0044036, the cell wall macromolecule metabolic process?
Molecular Function:  0004040, the amidase activity?
Molecular Function:  0016787, the hydrolase activity?


Linking to UniprotKB
Linging to InterPro

Annotation

1-157
50
100
150
200
250
300
350
400
450
500
550
600
628

1-157
: EAD, Amidase domain, derived from Ply187;
Domain and repeats:
11-145
: IPR007921,CHAP domain;
14-145
: IPR007921,CHAP domain;
GO term prediction:
MALPKTGKPTAKQVVDWAINLIGSGVDVDGYYGRQCWDLPNYIFNRYWNFKTPGNARDMAWYRYPEGFKVFRNTSDFVPKPGDIAVWTGGNYNWNTWGHTGIVVGPSTKSYFYSVDQWNNSNSYVGSPAAKIKHSYFGVTHFVRPAYKAEPKPTPPHHH
  BlastP to GMEnzy

Production

  1.  Expressed by pET28a(+) in E. coli BL21(DE3),  Purified by a nickel nitrilotriacetic acid column

Activity

    No activity data found on GM0165

Reference

  1. Yang H, Zhang Y, Yu J, Huang Y, Zhang XE. (2013) A novel chimeric lysin with high antimicrobial activity against methicillin-resistant Staphylococcus aureus in vitro and in vivo.. Antimicrob Agents Chemother. :. [doi:10.1128/AAC.01793-13.] [PMID:24189265] [FULL TEXT]

Comments

    No comments found on GM0165


CAPTCHA Image   Reload Image
Enter Code*: