Detail of GM0168


Summary

The genetically modified enzybiotic, named pGDC187 , constructed by Mutagenesis strategy, decrease the lytic activity.
With  pGDC187
  Sequence Length:  206 AA.
  Mass:  22743.6 Da.
  Isoelectric Point:  9.97
  Function:  

Construction

GM0168, constructed by Mutagenesis strategy.
Q6Y7R1: ORF56
P10547: Lysostaphin
UniProt

IPR007921:674-805
IPR003646:278-367
IPR003646:411-481
InterPro

GM0168:1-144
GM0168:145-208
GMEnzy

30
60
90
120
150
180
210
240
270
300
330
360
390
420
450
480
510
540
570
600
630
660
690
720
750
780
808
30
60
90
120
150
180
210
240
270
300
330
360
390
420
450
480
493

Details:
GM0168[1-144]: derive from protein Q6Y7R1 sequence 669-808

Q6Y7R1, 808 AA., the ORF56 from Staphylococcus phage K

Source: Staphylococcus phage K

Domains and repeats

674-805:  IPR007921, the CHAP domain

GO term prediction

    No GO info found on GM0168

Linking to UniprotKB
Linging to InterPro
GM0168[145-208]: derive from protein P10547 sequence 411-485

P10547, 493 AA., the Lysostaphin from Staphylococcus simulans

Source: Staphylococcus simulans

Domains and repeats

239-382:  IPR011055, the Duplicated hybrid motif?
411-481:  IPR003646, the SH3-like domain, bacterial-type
278-367:  IPR003646, the Peptidase M23?

GO term prediction

    No GO info found on GM0168

Linking to UniprotKB
Linging to InterPro

Annotation

1-144
145-208
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
900
950
1000
1050
1100
1150
1200
1250
1300
1301

1-144
: EAD, CHAP domain, derived from the phage tailassociated muralytic enzyme of Phage K;
145-208
: CBD, SH3b domain, derived from lysostaphin;
110
: MUT, mutation with E110D ;
Domain and repeats:
145-204
: IPR003646,SH3-like domain, bacterial-type;
6-141
: IPR007921,CHAP domain;
GO term prediction:
MSLDSLKKYNGKLPKHDPSFVQPGNRHYKYQCTWYAYNRRGQLGIPVPLWGDAADWIGGAKGAGYGVGRTPKQGACVIWQRGVQGGSPQYGHVAFVEKVLDGGKKIFISDHNYATPNGYGTRTIDMSSAIGKNAQFIYDKK-YKSESASFTPNTDIITRTTGPFRSMPQSGVLKAGQTIHYDEVMKQDGHVWVGYTGNSGQRIYLPV
  BlastP to GMEnzy

Production

  1.  Expressed by inducible T9 expression system in E. coli ER2566,  Purified by ammonium sulfate (20

Activity

    No activity data found on GM0168

Reference

  1. Saravanan SR, Paul VD, George S, Sundarrajan S, Kumar N. (2013) Properties and mutation studies of a bacteriophage-derived chimeric recombinant staphylolytic protein P128: Comparison to recombinant lysostaphin.. Bacteriophage. REF00443:e26564. [doi:10.4161/bact.26564.] [PMID:24251076] [FULL TEXT]

Comments

    No comments found on GM0168


CAPTCHA Image   Reload Image
Enter Code*: