Detail of GM0172


Summary

The genetically modified enzybiotic, named EAD118_I_CBDPSA , constructed by Domains Assembly strategy, improve the lytic activity.
With  EAD118_I_CBDPSA
  Sequence Length:  296 AA.
  Mass:  33432.7 Da.
  Isoelectric Point:  10.2
  Function:  

Construction

GM0172, constructed by Domains Assembly strategy.
Q37976: L-alanyl-D-glutamate peptidase
Q8W5Y8: Ply protein
UniProt

IPR009045:8-121
IPR022016:153-193
InterPro

GM0172:1-153
GM0172:154-296
GMEnzy

30
60
90
120
150
180
210
240
270
281
30
60
90
120
150
180
210
240
270
300
314

Details:
GM0172[1-153]: derive from protein Q37976 sequence 1-153

Q37976, 281 AA., the L-alanyl-D-glutamate peptidase from Listeria phage A118 (Bacteriophage A118)

Source: Listeria phage A118 (Bacteriophage A118)

Domains and repeats

8-121:  IPR009045, the Hedgehog signalling/DD-peptidase zinc-binding doma
153-193:  IPR022016, the Domain of unknown function DUF3597

GO term prediction

    No GO info found on GM0172

Linking to UniprotKB
Linging to InterPro
GM0172[154-296]: derive from protein Q8W5Y8 sequence 172-314

Q8W5Y8, 314 AA., the Ply protein from Listeria phage PSA

Source: Listeria phage PSA

Domains and repeats

    No sequence info found on GM0172

GO term prediction

    No GO info found on GM0172

Linking to UniprotKB
Linging to InterPro

Annotation

1-153
154-296
50
100
150
200
250
300
350
400
450
500
550
595

1-153
: EAD, L-alanoyl-D-glutamate peptidase domain, derived from Listeria phage endolysin Ply118;
154-296
: CBD, CBDPSA domain, derived from L. monocytogenes PSA endolysin PlyPSA;
Domain and repeats:
8-121
: IPR009045,Hedgehog signalling/DD-peptidase zinc-binding doma;
GO term prediction:
MTSYYYSRSLANVNKLADNTKAAARKLLDWSESNGIEVLIYETIRTKEQQAANVNSGASQTMRSYHLVGQALDFVMAKGKTVDWGAYRSDKGKKFVAKAKSLGFEWGGDWSGFVDNPHLQFNYKGYGTDTFGKGASTSNSSKPSADTNTNSLG-TGKTVAAKNPNRHSGAVVDSVPMLSKMDFKSSPIKMYKAGSSLLVYEHNKYWYKAYINDKLCYIYKSFCISNGKKDAKGRIKVRIKSAKDLRIPVWNNTKLNSGKIKWYSPGTKLSWYDNKKGYLELWY EKDGWYYTANYFLK
  BlastP to GMEnzy

Production

  1.  Expressed by pQE-30 in E. coli XL1-Blue MRF,  Purified by immobilized metal affinity chromatography (IMAC) with Ni-NTA Superflow resin (Qiagen) using Micro Biospin columns (Bio-Rad)

Activity

    No activity data found on GM0172

Reference

  1. Schmelcher M, Tchang VS, Loessner MJ. (2011) Domain shuffling and module engineering of Listeria phage endolysins for enhanced lytic activity and binding affinity.. Microb Biotechnol . REF0047:651-662. [doi:10.1111/j.1751-7915.2011.00263.x] [PMID:21535426] [FULL TEXT]

Comments

    No comments found on GM0172


CAPTCHA Image   Reload Image
Enter Code*: