Detail of GM0174


Summary

The genetically modified enzybiotic, named EAD118_III_CBDPSA , constructed by Domains Assembly strategy, improve the lytic activity.
With  EAD118_III_CBDPSA
  Sequence Length:  276 AA.
  Mass:  31554.8 Da.
  Isoelectric Point:  10.21
  Function:  

Construction

GM0174, constructed by Domains Assembly strategy.
Q37976: L-alanyl-D-glutamate peptidase
Q8W5Y8: Ply protein
UniProt

IPR009045:8-121
IPR022016:153-193
InterPro

GM0174:1-133
GM0174:134-276
GMEnzy

30
60
90
120
150
180
210
240
270
281
30
60
90
120
150
180
210
240
270
300
314

Details:
GM0174[1-133]: derive from protein Q37976 sequence 1-113

Q37976, 281 AA., the L-alanyl-D-glutamate peptidase from Listeria phage A118 (Bacteriophage A118)

Source: Listeria phage A118 (Bacteriophage A118)

Domains and repeats

8-121:  IPR009045, the Hedgehog signalling/DD-peptidase zinc-binding doma
153-193:  IPR022016, the Domain of unknown function DUF3597

GO term prediction

    No GO info found on GM0174

Linking to UniprotKB
Linging to InterPro
GM0174[134-276]: derive from protein Q8W5Y8 sequence 172-314

Q8W5Y8, 314 AA., the Ply protein from Listeria phage PSA

Source: Listeria phage PSA

Domains and repeats

    No sequence info found on GM0174

GO term prediction

    No GO info found on GM0174

Linking to UniprotKB
Linging to InterPro

Annotation

1-133
134-276
50
100
150
200
250
300
350
400
450
500
550
595

1-133
: EAD, L-alanoyl-D-glutamate peptidase domain, derived from Listeria phage endolysin Ply118;
134-276
: CBD, CBDPSA domain, derived from L. monocytogenes PSA endolysin PlyPSA;
Domain and repeats:
GO term prediction:
MTSYYYSRSLANVNKLADNTKAAARKLLDWSESNGIEVLIYETIRTKEQQAANVNSGASQTMRSYHLVGQALDFVMAKGKTVDWGAYRSDKGKKFVAKAKSLGFEWGGDWSGFVDNPHLQFNYKGYGTDTFGK-TGKTVAAKNPNRHSGAVVDSVPMLSKMDFKSSPIKMYKAGSSLLVYEHNKYWYKAYINDKLCYIYKSFCISNGKKDAKGRIKVRIKSAKDLRIPVWNNTKLNSGKIKWYSPGTKLSWYDNKKGYLELWY EKDGWYYTANYFLK
  BlastP to GMEnzy

Production

  1.  Expressed by pQE-30 in E. coli XL1-Blue MRF,  Purified by immobilized metal affinity chromatography (IMAC) with Ni-NTA Superflow resin (Qiagen) using Micro Biospin columns (Bio-Rad)

Activity

    No activity data found on GM0174

Reference

  1. Schmelcher M, Tchang VS, Loessner MJ. (2011) Domain shuffling and module engineering of Listeria phage endolysins for enhanced lytic activity and binding affinity.. Microb Biotechnol . REF0047:651-662. [doi:10.1111/j.1751-7915.2011.00263.x] [PMID:21535426] [FULL TEXT]

Comments

    No comments found on GM0174


CAPTCHA Image   Reload Image
Enter Code*: