Detail of GM0175


Summary

The genetically modified enzybiotic, named EADPSA_CBD118_D , constructed by Domains Assembly strategy, change or extend lytic spectrum.
With  EADPSA_CBD118_D
  Sequence Length:  377 AA.
  Mass:  40875 Da.
  Isoelectric Point:  10.31
  Function:  

Construction

GM0175, constructed by Domains Assembly strategy.
Q8W5Y8: Ply protein
Q37976: L-alanyl-D-glutamate peptidase
UniProt

IPR009045:8-121
IPR022016:153-193
InterPro

GM0175:1-185
GM0175:186-377
GMEnzy

30
60
90
120
150
180
210
240
270
300
314
30
60
90
120
150
180
210
240
270
281

Details:
GM0175[1-185]: derive from protein Q8W5Y8 sequence 1-185

Q8W5Y8, 314 AA., the Ply protein from Listeria phage PSA

Source: Listeria phage PSA

Domains and repeats

    No sequence info found on GM0175

GO term prediction

    No GO info found on GM0175

Linking to UniprotKB
Linging to InterPro
GM0175[186-377]: derive from protein Q37976 sequence 90-281

Q37976, 281 AA., the L-alanyl-D-glutamate peptidase from Listeria phage A118 (Bacteriophage A118)

Source: Listeria phage A118 (Bacteriophage A118)

Domains and repeats

8-121:  IPR009045, the Hedgehog signalling/DD-peptidase zinc-binding doma
153-193:  IPR022016, the Domain of unknown function DUF3597

GO term prediction

    No GO info found on GM0175

Linking to UniprotKB
Linging to InterPro

Annotation

1-185
186-377
50
100
150
200
250
300
350
400
450
500
550
595

1-185
: EAD, N-acetylmuramoyl-L-alanine amidases domain, derived from L. monocytogenes PSA endolysin PlyPSA;
186-377
: CBD, CBD118 domain, derived from Listeria phage endolysin Ply118;
Domain and repeats:
249-289
: IPR022016,Domain of unknown function DUF3597;
GO term prediction:
MSNYSMSRGHSDKCVGAEDILSEIKEAEKVLNAASDELKREGHNVKTFIDRTSTTQSANLNKIVNWHNANPADVHISVHLNAGKGTGVEVWYYAGDEKGRKLAVEISAKMAKALGLPNRGAKATKDLRFLNSTKGTAVLLEVCFVDRKEDANAIHKSGMYDKLGIAIAEGLTGKTVAAKNPNRHS-DKGKKFVAKAKSLGFEWGGDWSGFVDNPHLQFNYKGYGTDTFGKGASTSNSSKPSADTNTNSLGLVDYMNLNKLDSSFANRKKLATSYGIKNYSGTATQNTTLLAKLKAGKPHTPASKNTYYTENPRKVKTLVQCDLYKSVDFTTKNQTGGTFPPGTVFTISGMGKTKGGTPRLKTKSGYYLTANTKFVKKI
  BlastP to GMEnzy

Production

  1.  Expressed by pQE-30 in E. coli XL1-Blue MRF,  Purified by immobilized metal affinity chromatography (IMAC) with Ni-NTA Superflow resin (Qiagen) using Micro Biospin columns (Bio-Rad)

Activity

    No activity data found on GM0175

Reference

  1. Schmelcher M, Tchang VS, Loessner MJ. (2011) Domain shuffling and module engineering of Listeria phage endolysins for enhanced lytic activity and binding affinity.. Microb Biotechnol . REF0047:651-662. [doi:10.1111/j.1751-7915.2011.00263.x] [PMID:21535426] [FULL TEXT]

Comments

    No comments found on GM0175


CAPTCHA Image   Reload Image
Enter Code*: