Record in detail


General Info

  • lamp_id:L01A003064
  • Name:DEF_TOBAC
  • FullName:Defensin-like protein
  • Source:Nicotiana tabacum
  • Mass:8939.4 Da
  • Sequence Length:80 aa
  • Isoelectric Point:6.98
  • Activity:Antimicrobial
  • Sequence
        RECKTESNTFPGICITKPPCRKACISEKFTDGHCSKLLRRCLCTKPCVFDEKMIKTGAETLVEEAKTLAAALLEEEIMDN
  • Function:Involved in floral organogenesis. May play a protective role in flowers by protecting the reproductive organs from potential pathogen attack.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003064    From 1 To 80 E-value: 4.99983e-42 Score: 161
        RECKTESNTFPGICITKPPCRKACISEKFTDGHCSKLLRRCLCTKPCVFDEKMIKTGAETLVEEAKTLAAALLEEEIMDN
  • 2. L02A000922    From 1 To 47 E-value: 4e-23 Score: 98.2
        RECKTESNTFPGICITKPPCRKACISEKFTDGHCSKLLRRCLCTKPC
  • 3. L01A002688    From 1 To 47 E-value: 7e-23 Score: 97.4
        RECKTESNTFPGICITKPPCRKACISEKFTDGHCSKILRRCLCTKPC
  • 4. L11A010690    From 1 To 47 E-value: 3e-22 Score: 95.5
        RECKTESNTFPGICITKPPCRKACISEKFTDGHCSKILRRCFCTRPC
  • 5. L02A000985    From 1 To 47 E-value: 1e-21 Score: 93.2
        KDCKTESNTFPGICITKPPCRKACIKEKFTDGHCSKILRRCLCTKPC

Structure

  •   Domains
  •   1  Name:G_Purothionin    Interpro Link:IPR008177
  •   2  Name:Gamma-thionin    Interpro Link:IPR008176
  •   3  Name:Knot1    Interpro Link:IPR003614
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Cheung A.Y.,Wu H.-M.,Morse M.-J.,Kawata E.E.,Gu Q.,
  •   Title:A flower-specific cDNA encoding a novel thionin in tobacco.
  •   Journal:Mol. Gen. Genet., 1992, 234, 89-96  [MEDLINE:92357021]
  •   [2]  Craik D.J.,Anderson M.A.,Scanlon M.J.,Schirra H.J.,Lay F.T.,
  •   Title:The three-dimensional solution structure of NaD1, a new floral defensin from Nicotiana alata and its application to a homology model of the crop defense protein alfAFP.
  •   Journal:J. Mol. Biol., 2003, 325, 175-188  [PubMed:12473460]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: