Record in detail


General Info

  • lamp_id:L01A003075
  • Name:NLTP_BETVU
  • FullName:Non-specific lipid-transfer protein
  • Source:Beta vulgaris
  • Mass:8968.3 Da
  • Sequence Length:91 aa
  • Isoelectric Point:8.98
  • Activity:Antifungal
  • Sequence
        ITCGLVASKLAPCIGYLQGAPGPSAACCGGIKSLNSAAASPADRKTACTCLKSAATSIKGINYGKAASLPRQCGVSVPYAISPNTNCNAIH
  • Function:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues. Also has fungicide activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003075    From 1 To 91 E-value: 0 Score: 177
        ITCGLVASKLAPCIGYLQGAPGPSAACCGGIKSLNSAAASPADRKTACTCLKSAATSIKGINYGKAASLPRQCGVSVPYAISPNTNCNAIH
  • 2. L06AT00111    From 1 To 91 E-value: 0 Score: 176
        ITCGLVASKLAPCIGYLQGAPGPSAACCGGIKSLNSAAASPADRKTACTCLKSAATSMKGINYGKAASLPRQCGVSIPYAISPNTNCNAIH
  • 3. L06AT00122    From 2 To 91 E-value: 4e-26 Score: 108
        ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASSTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRV
  • 4. L06AT00132    From 2 To 91 E-value: 7e-26 Score: 107
        ITCGMVSSKLAPCIGYLKGGPLGGGCC-GGIKALNAAAATTPDRKTACNCLKSAANAIKGINYGKAAGLPGMCGVHIPYAISPSTNCNAVH
  • 5. L06AT00134    From 2 To 92 E-value: 9e-26 Score: 107
        VTCGQVSSAIGPCLSYARGQGSGPSAGCCSGVRSLNSAARTTADRRAACNCLKNAARGIRGLNVGKAASIPSKCGVSIPYTISTSTDCSRV

Structure

  •   Domains
  •   1  Name:Bifunc_inhib/LTP/seed_store    Interpro Link:IPR016140
  •   2  Name:Lipid_transfer_prot_hlx-dom    Interpro Link:IPR013770
  •   3  Name:Plant_LTP    Interpro Link:IPR000528
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Mikkelsen J.D.,Madrid S.M.,Nielsen J.E.,Nielsen K.K.,
  •   Title:New antifungal proteins from sugar beet (Beta vulgaris L.) showing homology to non-specific lipid transfer proteins.
  •   Journal:Plant Mol. Biol., 1996, 31, 539-552  [MEDLINE:96382423]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: