Record in detail


General Info

  • lamp_id:L01A003154
  • Name:NKL_PIG
  • FullName:Antimicrobial peptide NK-lysin
  • Source:Sus scrofa
  • Mass:8777.5 Da
  • Sequence Length:77 aa
  • Isoelectric Point:9.91
  • Activity:Antibacterial
  • Sequence
        LICESCRKIIQKLEDMVGPQPNEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKDILTGKKPQAICVDIKICKE
  • Function:May be an effector molecule of cytotoxic activity. High activity against E.coli and B.megaterium, moderate against A.calcoaceticus and S.pyogenes. No activity against P.aeruginosa, S.aureus and Salmonella. Has some antifungal activity against C.albicans.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003154    From 1 To 77 E-value: 2e-39 Score: 152
        LICESCRKIIQKLEDMVGPQPNEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKDILTGKKPQAICVDIKICKE
  • 2. L01A002953    From 2 To 78 E-value: 2e-39 Score: 152
        LICESCRKIIQKLEDMVGPQPNEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKDILTGKKPQAICVDIKICKE
  • 3. L12A03456|    From 2 To 78 E-value: 2e-37 Score: 145
        LICESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE
  • 4. L02A000429    From 2 To 78 E-value: 2e-37 Score: 145
        LICESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE
  • 5. L11A002049    From 1 To 77 E-value: 1e-36 Score: 143
        YFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Structure

  •   Domains
  •   1  Name:SapB_1    Interpro Link:IPR007856
  •   2  Name:SapB_2    Interpro Link:IPR008138
  •   3  Name:Saposin-like    Interpro Link:IPR011001
  •   4  Name:SaposinB    Interpro Link:IPR008139
  •   Structures

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli D21  MIC:  70.22 μg/ml  (8 μM)  
  •   2  Target:  Bacillus megaterium  MIC:  7.02 μg/ml  (0.799772 μM)  
  •   3  Target:  moderate PIG Escherichia coli Bd2221/75  MIC:  342.32 μg/ml  (38.9997 μM)  
  •   4  Target:  Candida albicans  MIC:  272.1 μg/ml  (30.9997 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Bergman T.,Boman A.,Agerberth B.,Gunne H.,Andersson M.,
  •   Title:NK-lysin, a novel effector peptide of cytotoxic T and NK cells. Structure and cDNA cloning of the porcine form, induction by interleukin 2, antibacterial and antitumour activity.
  •   Journal:EMBO J., 1995, 14, 1615-1625  [MEDLINE:95255219]
  •   [2]  Otting G.,Ruysschaert J.-M.,Andersson M.,Liepinsh E.,
  •   Title:Saposin fold revealed by the NMR structure of NK-lysin.
  •   Journal:Nat. Struct. Biol., 1997, 4, 793-795  [MEDLINE:97475218]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: