Record in detail


General Info

  • lamp_id:L02A001082
  • Name:Hyfl A
  • FullName:Hyfl A
  • Source:Australian Hybanthus floribundus E
  • Mass:3273.8 Da
  • Sequence Length:31 aa
  • Isoelectric Point:6.07
  • Activity:Antibacterial,Antifungal,Antiviral,,,Insecticidal
  • Sequence
        SISCGESCVYIPCTVTALVGCTCKDKVCYLN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001082    From 1 To 31 E-value: 0.000000000002 Score: 62.8
        SISCGESCVYIPCTVTALVGCTCKDKVCYLN
  • 2. L12A06270|    From 46 To 75 E-value: 0.0000000004 Score: 55.1
        IPCAESCVYIPCTITALLGCSCKDKVCYKN
  • 3. L13A012166    From 1 To 31 E-value: 0.0000000004 Score: 55.1
        GIPCGESCVYIPCTVTALLGCSCKDKVCYKN
  • 4. L12A03137|    From 2 To 31 E-value: 0.0000000006 Score: 54.7
        IPCAESCVWIPCTVTALLGCSCKDKVCYLN
  • 5. L12A06268|    From 46 To 75 E-value: 0.0000000007 Score: 54.3
        IPCAESCVYIPCTITALFGCSCKDKVCYNN

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: