Record in detail


General Info

  • lamp_id:L03A000278
  • Name:DEF4_RABIT
  • FullName:Corticostatin-4
  • Source:Oryctolagus cuniculus
  • Mass:10431.1 Da
  • Sequence Length:95 aa
  • Isoelectric Point:7.8
  • Activity:Antimicrobial
  • Sequence
        MRTLALLAAILLVALQAQAEHISVSIDEVVDQQPPQAEDQDVAIYVKEHESSALEALGVKAGVVCACRRALCLPLERRAGFCRIRGRIHPLCCRR
  • Function:This peptide has antibiotic, anti-fungi and antiviral activity. It also inhibits corticotropin (ACTH) stimulated corticosterone production.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000278    From 1 To 95 E-value: 0 Score: 187
        MRTLALLAAILLVALQAQAEHISVSIDEVVDQQPPQAEDQDVAIYVKEHESSALEALGVKAGVVCACRRALCLPLERRAGFCRIRGRIHPLCCRR
  • 2. L03A000279    From 1 To 95 E-value: 4.00001e-41 Score: 158
        MRTLALLAAILLVALQAQAEHVSVSIDEVVDQQPPQAEDQDVAIYVKEHESSALEALGVKAGVVCACRRALCLPRERRAGFCRIRGRIHPLCCRR
  • 3. L03A000280    From 1 To 95 E-value: 1e-22 Score: 97.1
        MRTLALLAAILLVTLQAQAELHSGMADDGVDQQQPRAQDLDVAVYIKQDETSPLEVLGAKAGVFCTCRGFLCGSGERASGSCTINGVRHTLCCRR
  • 4. L03A000281    From 1 To 95 E-value: 4e-22 Score: 95.1
        MRTLALLAAILLVTLQAQAELHSGMADDGVDQQQPRAQDLDVAVYIKQDETSPLEVLGAKAGVSCTCRRFSCGFGERASGSCTVNGVRHTLCCRR
  • 5. L12A09206|    From 1 To 94 E-value: 9e-21 Score: 90.5
        MRTLAILAAILLFTLQAQAESLQERADEVATQEQPGEDDQDLAVSFEENGLSTLRASGSQAGRTCYCRNKRCFTPEFHAGKCKVERRTYKLCCR

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   4  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lehrer R.I.,Delange R.J.,Brown D.M.,Selsted M.E.,
  •   Title:Primary structures of MCP-1 and MCP-2, natural peptide antibiotics of rabbit lung macrophages.
  •   Journal:J. Biol. Chem., 1983, 258, 14485-14489  [MEDLINE:84061901]
  •   [2]  Lehrer R.I.,Harwig S.S.L.,Delange R.J.,Brown D.M.,Selsted M.E.,
  •   Title:Primary structures of six antimicrobial peptides of rabbit peritoneal neutrophils.
  •   Journal:J. Biol. Chem., 1985, 260, 4579-4584  [MEDLINE:85182561]
  •   [3]  Talmadge K.,Tumolo A.,Valore E.V.,Rayner J.R.,Ganz T.,
  •   Title:The structure of the rabbit macrophage defensin genes and their organ-specific expression.
  •   Journal:J. Immunol., 1989, 143, 1358-1365  [MEDLINE:89309825]
  •   [4]  Solomon S.,Zhu Q.,
  •   Title:Isolation and mode of action of rabbit corticostatic (antiadrenocorticotropin) peptides.
  •   Journal:Endocrinology, 1992, 130, 1413-1423  [MEDLINE:92164536]
  •   [5]  Pardi A.,Selsted M.E.,Zhang X.-L.,
  •   Title:NMR studies of defensin antimicrobial peptides. 1. Resonance assignment and secondary structure determination of rabbit NP-2 and human HNP-1.
  •   Journal:Biochemistry, 1992, 31, 11348-11356  [MEDLINE:93075733]
  •   [6]  Yip P.F.,Skalicky J.J.,Selsted M.E.,Zhang X.-L.,Pardi A.,
  •   Title:NMR studies of defensin antimicrobial peptides. 2. Three-dimensional structures of rabbit NP-2 and human HNP-1.
  •   Journal:Biochemistry, 1992, 31, 11357-11364  [MEDLINE:93075734]
  •   [7]  Palfree R.G.E.,Solomon S.,Tremblay A.,Sadro L.C.,
  •   Title:Differential expression of corticostatins/defensins: higher levels of CS-4 (NP-2) transcripts compared with CS-6 (NP-5) in rabbit lung.
  •   Journal:Biochem. Biophys. Res. Commun., 1993, 190, 1009-1016  [MEDLINE:93176141]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: