Record in detail


General Info

  • lamp_id:L03A000280
  • Name:DEF6_RABIT
  • FullName:Neutrophil antibiotic peptide NP-5
  • Source:Oryctolagus cuniculus
  • Mass:10121.5 Da
  • Sequence Length:95 aa
  • Isoelectric Point:6.48
  • Activity:Antimicrobial
  • Sequence
        MRTLALLAAILLVTLQAQAELHSGMADDGVDQQQPRAQDLDVAVYIKQDETSPLEVLGAKAGVFCTCRGFLCGSGERASGSCTINGVRHTLCCRR
  • Function:Microbicidal activity.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P07466
  •   2  Database:AMD  DEF6_RABIT

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000280    From 1 To 95 E-value: 0 Score: 193
        MRTLALLAAILLVTLQAQAELHSGMADDGVDQQQPRAQDLDVAVYIKQDETSPLEVLGAKAGVFCTCRGFLCGSGERASGSCTINGVRHTLCCRR
  • 2. L03A000281    From 1 To 95 E-value: 5.00264e-43 Score: 164
        MRTLALLAAILLVTLQAQAELHSGMADDGVDQQQPRAQDLDVAVYIKQDETSPLEVLGAKAGVSCTCRRFSCGFGERASGSCTVNGVRHTLCCRR
  • 3. L03A000279    From 1 To 95 E-value: 4e-20 Score: 88.6
        MRTLALLAAILLVALQAQAEHVSVSIDEVVDQQPPQAEDQDVAIYVKEHESSALEALGVKAGVVCACRRALCLPRERRAGFCRIRGRIHPLCCRR
  • 4. L03A000278    From 1 To 95 E-value: 6e-20 Score: 87.8
        MRTLALLAAILLVALQAQAEHISVSIDEVVDQQPPQAEDQDVAIYVKEHESSALEALGVKAGVVCACRRALCLPLERRAGFCRIRGRIHPLCCRR
  • 5. L05ADEF181    From 1 To 93 E-value: 7e-19 Score: 84.3
        MRTLTLLSAFLLVALQAWAEPLQARADEMPAQKQPPADDQDVVIYFSGDDSSSLQVPGSTKGLICHCRVLYCLFGEHLGGTSFIHGERYPICC

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   4  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lehrer R.I.,Harwig S.S.L.,Delange R.J.,Brown D.M.,Selsted M.E.,
  •   Title:Primary structures of six antimicrobial peptides of rabbit peritoneal neutrophils.
  •   Journal:J. Biol. Chem., 1985, 260, 4579-4584  [MEDLINE:85182561]
  •   [2]  Bassolino D.A.,Morrison R.D.,Selsted M.E.,Hare D.R.,Pardi A.,
  •   Title:Solution structures of the rabbit neutrophil defensin NP-5.
  •   Journal:J. Mol. Biol., 1988, 201, 625-636  [MEDLINE:88332997]
  •   [3]  Pardi A.,Kitchen D.B.,Bassolino D.A.,Levy R.M.,
  •   Title:Solution structures of proteins from NMR data and modeling: alternative folds for neutrophil peptide 5.
  •   Journal:Biochemistry, 1989, 28, 9361-9372  [MEDLINE:90122800]
  •   [4]  Pardi A.,Levy R.M.,Bassolino D.A.,Kominos D.,
  •   Title:Analysis of side-chain conformational distributions in neutrophil peptide-5 NMR structures.
  •   Journal:Biopolymers, 1990, 29, 1807-1822  [MEDLINE:91002855]
  •   [5]  Ganz T.,Rayner J.R.,Couto M.,Michaelson D.,
  •   Title:Cationic defensins arise from charge-neutralized propeptides: a mechanism for avoiding leukocyte autocytotoxicity?
  •   Journal:J. Leukoc. Biol., 1992, 51, 634-639  [MEDLINE:92308748]
  •   [6]  Palfree R.G.E.,Solomon S.,Tremblay A.,Sadro L.C.,
  •   Title:Differential expression of corticostatins/defensins: higher levels of CS-4 (NP-2) transcripts compared with CS-6 (NP-5) in rabbit lung.
  •   Journal:Biochem. Biophys. Res. Commun., 1993, 190, 1009-1016  [MEDLINE:93176141]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: