Record in detail


General Info

  • lamp_id:L04ABAC086
  • Name:Q3SAX6_CARDV
  • FullName:
  • Source:Carnobacterium divergens
  • Mass:4223.9 Da
  • Sequence Length:46 aa
  • Isoelectric Point:9.67
  • Activity:Antimicrobial
  • Sequence
        AAPKITQKQKNCVNGQLGGMLAGALGGPGGVVLGGIGGAIAGGCFN
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07975|    From 30 To 75 E-value: 1e-19 Score: 87
        AAPKITQKQKNCVNGQLGGMLAGALGGPGGVVLGGIGGAIAGGCFN
  • 2. L04ABAC086    From 1 To 46 E-value: 3e-19 Score: 85.5
        AAPKITQKQKNCVNGQLGGMLAGALGGPGGVVLGGIGGAIAGGCFN
  • 3. L12A07332|    From 43 To 73 E-value: 6.5 Score: 21.2
        RGILTDTLKGAAKNVAGVLLDKLKCKITGGC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Vederas J.C.,Roy K.L.,Sailer M.,Van Belkum M.J.,Worobo R.W.,
  •   Title:A signal peptide secretion-dependent bacteriocin from Carnobacterium divergens.
  •   Journal:J. Bacteriol., 1995, 177, 3143-3149  [MEDLINE:95286495]
  •   [2]  Stiles M.E.,van Belkum M.J.,
  •   Title:Characterization of the theta-type plasmid pCD3.4 from Carnobacterium divergens, and modulation of its host range by RepA mutation.
  •   Journal:Microbiology, 2006, 152, 171-178  [PubMed:16385127]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: