Record in detail


General Info

  • lamp_id:L04ABAC169
  • Name:A4UVR2_9LACT
  • FullName:
  • Source:Lactococcus lactis
  • Mass:5766.9 Da
  • Sequence Length:52 aa
  • Isoelectric Point:10.84
  • Activity:Antimicrobial
  • Sequence
        AGFLKVVQLLAKYGSKAVQWAWANKGKILDWLNAGQAIDWVVSKIKQILGIK
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06215|    From 2 To 53 E-value: 2e-23 Score: 99
        AGFLKVVQLLAKYGSKAVQWAWANKGKILDWLNAGQAIDWVVSKIKQILGIK
  • 2. L04ABAC169    From 1 To 52 E-value: 3e-23 Score: 98.6
        AGFLKVVQLLAKYGSKAVQWAWANKGKILDWLNAGQAIDWVVSKIKQILGIK
  • 3. L04ABAC170    From 2 To 53 E-value: 2e-22 Score: 95.9
        AGFLKVVQILAKYGSKAVQWAWANKGKILDWINAGQAIDWVVEKIKQILGIK
  • 4. L12A06213|    From 2 To 51 E-value: 2e-21 Score: 92.8
        AGFLKVVQILAKYGSKAVQWAWANKGKILDWINAGQAIDWVVEKIKQILG
  • 5. L04ABAC210    From 2 To 49 E-value: 0.000000003 Score: 52.4
        AAFMKLIQFLATKGQKYVSLAWKHKGTILKWINAGQSFEWIYKQIKKL

Structure

  •   Domains
  •   1  Name:Bacteriocin_II_aureocin-like    Interpro Link:IPR020968
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Yoneyama F.,Koga S.,Zendo T.,Ichimasa S.,Fujita K.,
  •   Title:Structural analysis and characterization of lacticin Q, a novel bacteriocin belonging to a new family of unmodified bacteriocins of gram-positive bacteria.
  •   Journal:Appl. Environ. Microbiol., 2007, 73, 2871-2877  [PubMed:17351096]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: