Record in detail
General Info
- lamp_id:L06AT00183
- Name:CYO8_VIOOD
- FullName:Cycloviolacin-O8
- Source:Viola odorata
- Mass:3251.8 Da
- Sequence Length:31 aa
- Isoelectric Point:8.11
- Activity:Antimicrobial
- Sequence
GTLPCGESCVWIPCISSVVGCSCKSKVCYKN - Function:Probably participates in a plant defense mechanism.
Cross-Linking
- Cross-linking
- 1 Database:DBAASP 12162
- 2 Database:dbAMP dbAMP_04168
- 3 Database:SATPdb satpdb12354
- 4 Database:Uniprot P58440
- 5 Database:PHY PHYT00183
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L06AT00183 From 1 To 31 E-value: 0.000000000003 Score: 62.4
GTLPCGESCVWIPCISSVVGCSCKSKVCYKN - 2. L06AT00163 From 1 To 31 E-value: 0.000000000004 Score: 61.6
GTLPCGESCVWIPCISAVVGCSCKSKVCYKN - 3. L02A001071 From 1 To 31 E-value: 0.000000000007 Score: 61.2
GTLPCGESCVWIPCISSVVGCSCKSKVCYKD - 4. L06AT00181 From 1 To 31 E-value: 0.000000000009 Score: 60.5
GTLPCGESCVWIPCISAAVGCSCKSKVCYKN - 5. L11A002497 From 1 To 31 E-value: 0.00000000001 Score: 60.5
GTLPCGESCVWIPCISSVVGCACKSKVCYKD
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Waine C.,Bond T.,Daly N.L.,Craik D.J.,
- Title:Plant cyclotides: a unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif.
- Journal:J. Mol. Biol., 1999, 294, 1327-1336 [MEDLINE:20069951]
- [2] Daly N.L.,Clark R.J.,Waine C.,Renda R.F.,Dutton J.L.,
- Title:Conserved structural and sequence elements implicated in the processing of gene-encoded circular proteins.
- Journal:J. Biol. Chem., 2004, 279, 46858-46867 [PubMed:15328347]
- [3] Craik D.J.,Colgrave M.L.,Ireland D.C.,
- Title:A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability.
- Journal:Biochem. J., 2006, 400, 1-12 [PubMed:16872274]
Comments
- Comments
No comments found on LAMP database