Record in detail


General Info

  • lamp_id:L06AT00183
  • Name:CYO8_VIOOD
  • FullName:Cycloviolacin-O8
  • Source:Viola odorata
  • Mass:3251.8 Da
  • Sequence Length:31 aa
  • Isoelectric Point:8.11
  • Activity:Antimicrobial
  • Sequence
        GTLPCGESCVWIPCISSVVGCSCKSKVCYKN
  • Function:Probably participates in a plant defense mechanism.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L06AT00183    From 1 To 31 E-value: 0.000000000003 Score: 62.4
        GTLPCGESCVWIPCISSVVGCSCKSKVCYKN
  • 2. L06AT00163    From 1 To 31 E-value: 0.000000000004 Score: 61.6
        GTLPCGESCVWIPCISAVVGCSCKSKVCYKN
  • 3. L02A001071    From 1 To 31 E-value: 0.000000000007 Score: 61.2
        GTLPCGESCVWIPCISSVVGCSCKSKVCYKD
  • 4. L06AT00181    From 1 To 31 E-value: 0.000000000009 Score: 60.5
        GTLPCGESCVWIPCISAAVGCSCKSKVCYKN
  • 5. L11A002497    From 1 To 31 E-value: 0.00000000001 Score: 60.5
        GTLPCGESCVWIPCISSVVGCACKSKVCYKD

Structure

  •   Domains
  •   1  Name:Cyclotide    Interpro Link:IPR005535
  •   2  Name:Cyclotide_bracelet_CS    Interpro Link:IPR012323
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Waine C.,Bond T.,Daly N.L.,Craik D.J.,
  •   Title:Plant cyclotides: a unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif.
  •   Journal:J. Mol. Biol., 1999, 294, 1327-1336  [MEDLINE:20069951]
  •   [2]  Daly N.L.,Clark R.J.,Waine C.,Renda R.F.,Dutton J.L.,
  •   Title:Conserved structural and sequence elements implicated in the processing of gene-encoded circular proteins.
  •   Journal:J. Biol. Chem., 2004, 279, 46858-46867  [PubMed:15328347]
  •   [3]  Craik D.J.,Colgrave M.L.,Ireland D.C.,
  •   Title:A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability.
  •   Journal:Biochem. J., 2006, 400, 1-12  [PubMed:16872274]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: