Record in detail


General Info

  • lamp_id:L11A002049
  • Name:Antimicrobial peptide des Gly1 NK-lysin
  • FullName:
  • Source: Sus scrofa
  • Mass:8873.5 Da
  • Sequence Length:77 aa
  • Isoelectric Point:9.15
  • Activity:Gram+Gram-FungusMammalian Cell
  • Sequence
        YFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  2049

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A002049    From 1 To 77 E-value: 8.99998e-41 Score: 157
        YFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE
  • 2. L03A000055    From 2 To 78 E-value: 8.99998e-41 Score: 157
        YFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE
  • 3. L02A000429    From 2 To 78 E-value: 3e-39 Score: 152
        LICESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE
  • 4. L12A03456|    From 2 To 78 E-value: 4e-39 Score: 151
        LICESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE
  • 5. L01A003154    From 1 To 77 E-value: 1e-36 Score: 143
        LICESCRKIIQKLEDMVGPQPNEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKDILTGKKPQAICVDIKICKE

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Andersson M , Gunne H, Agerberth B, Boman A, Bergman T, Sillard R, Jornvall H, Mutt V, Olsson B, Wig
  •   Title:nK-lysin, a novel effector peptide of cytotoxic T and nK cells
  •   Journal:EMBO J, 1995, 14, 1615-1625  [:7737114]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: