Record in detail


General Info

  • lamp_id:L11A002690
  • Name:Bovine hemoglobin beta chain (114-145)
  • FullName:
  • Source:
  • Mass:3574.1 Da
  • Sequence Length:32 aa
  • Isoelectric Point:10.88
  • Activity:Gram+Gram-
  • Sequence
        ARNFGKFFTPVLQADFQKVVAGVANALAHRYH
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  2690

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A002690    From 1 To 32 E-value: 0.0000000000001 Score: 67
        ARNFGKFFTPVLQADFQKVVAGVANALAHRYH
  • 2. L11A006441    From 1 To 32 E-value: 0.0000000000008 Score: 64.3
        ARNFGKEFTPVLQADFQKVVAGVANALAHRYH
  • 3. L11A006567    From 1 To 26 E-value: 0.0000000004 Score: 55.1
        FFTPVLQADFQKVVAGVANALAHRYH
  • 4. L11A002692    From 1 To 25 E-value: 0.000000002 Score: 53.1
        FTPVLQADFQKVVAGVANALAHRYH
  • 5. L13A025830    From 1 To 20 E-value: 0.000003 Score: 42.7
        QADFQKVVAGVANALAHRYH

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Guillochon D, Briand G, Kouach M, Mary P, Krier F, Traisnel J, Adje EY, Dubois-Delval V, nedjar-Arro
  •   Title:Bovine hemoglobin: an attractive source of antibacterial peptides
  •   Journal:Peptides, 2008, 29, 969-977  [:18342399]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: