Record in detail


General Info

  • lamp_id:L11A004486
  • Name:Cyclotide protein Mra19, Mram 8
  • FullName:
  • Source: Melicytus ramiflorus
  • Mass:3139.7 Da
  • Sequence Length:30 aa
  • Isoelectric Point:8.11
  • Activity:CancerMammalian Cell
  • Sequence
        GIPCGESCVFIPCLTSAIGCSCKSKVCYRN
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  4486

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A004486    From 1 To 30 E-value: 0.000000000005 Score: 61.6
        GIPCGESCVFIPCLTSAIGCSCKSKVCYRN
  • 2. L12A12205|    From 59 To 87 E-value: 0.000000000005 Score: 61.6
        IPCGESCVFIPCLTSAIGCSCKSKVCYKN
  • 3. L12A11674|    From 61 To 89 E-value: 0.000000000006 Score: 61.2
        IPCGESCVFIPCLTSAIGCSCKSKVCYKN
  • 4. L06AT00157    From 1 To 30 E-value: 0.00000000001 Score: 60.5
        GIPCGESCVYIPCLTSAIGCSCKSKVCYRN
  • 5. L06AT00178    From 1 To 30 E-value: 0.00000000001 Score: 60.5
        GIPCGESCVWIPCLTSAIGCSCKSKVCYRN

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  He W, Chan LY, Zeng G, Daly nL, Craik DJ, Tan n
  •   Title:Isolation and characterization of cytotoxic cyclotides from Viola philippica
  •   Journal:Peptides, 2011, 32, 1719-1723  [:21723349]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: