Record in detail


General Info

  • lamp_id:L11A004491
  • Name:Viphi G
  • FullName:
  • Source: Viola philippica
  • Mass:3196.7 Da
  • Sequence Length:31 aa
  • Isoelectric Point:7.73
  • Activity:CancerMammalian Cell
  • Sequence
        GSIPCGESCVFIPCISAIIGCSCSNKVCYKN
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  4491

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A004491    From 1 To 31 E-value: 0.000000000005 Score: 61.2
        GSIPCGESCVFIPCISAIIGCSCSNKVCYKN
  • 2. L13A014642    From 1 To 31 E-value: 0.000000000007 Score: 60.8
        GSIPCGESCVFIPCISAVIGCSCSNKVCYKN
  • 3. L13A013022    From 1 To 31 E-value: 0.000000000007 Score: 60.8
        GSIPCGESCVFIPCISAVIGCSCSNKVCYKN
  • 4. L13A011878    From 1 To 31 E-value: 0.000000000007 Score: 60.8
        GSIPCGESCVFIPCISAVIGCSCSNKVCYKN
  • 5. L13A020950    From 1 To 31 E-value: 0.00000000002 Score: 59.7
        GSIPCGESCVFIPCISAIIGCSCSSKVCYKN

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  He W, Chan LY, Zeng G, Daly nL, Craik DJ, Tan n
  •   Title:Isolation and characterization of cytotoxic cyclotides from Viola philippica
  •   Journal:Peptides, 2011, 32, 1719-1723  [:21723349]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: