Record in detail


General Info

  • lamp_id:L11A004599
  • Name:Defensin heliomicin [E43R]
  • FullName:
  • Source:
  • Mass:4817.4 Da
  • Sequence Length:44 aa
  • Isoelectric Point:8.38
  • Activity:Gram+Gram-Fungus
  • Sequence
        DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCRT
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  4599

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A004599    From 1 To 44 E-value: 4e-21 Score: 91.7
        DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCRT
  • 2. L01A002661    From 1 To 44 E-value: 1e-20 Score: 90.1
        DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET
  • 3. L11A004603    From 1 To 44 E-value: 5e-20 Score: 88.2
        DKLIGSCVWGAVNYTSDCAAECKRRGYKGGHCGSFANVNCWCRT
  • 4. L13A018520    From 1 To 44 E-value: 5e-20 Score: 88.2
        DKLIGSCVWGAVNYTSDCNGECKRRGYKGGYCGSFANVNCWCET
  • 5. L11A004604    From 1 To 44 E-value: 8e-20 Score: 87.4
        DKLIGSCVWGAVNYTSDCNGECLLRGYKGGHCGSFANVNCWCRT

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lamberty M, Caille A, Landon C, Tassin-Moindrot S, Hetru C, Bulet P, Vovelle F
  •   Title:Solution structures of the antifungal heliomicin and a selected variant with both antibacterial and antifungal activities
  •   Journal:Biochemistry, 2001, 40, 11995-12003  [:11580275]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: