Record in detail


General Info

  • lamp_id:L11A011557
  • Name:fCBD-LL37
  • FullName:
  • Source:
  • Mass:6618.4 Da
  • Sequence Length:54 aa
  • Isoelectric Point:9.16
  • Activity:Gram+Gram-Mammalian Cell
  • Sequence
        LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKCQDSERTFY
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  11557

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A011557    From 1 To 54 E-value: 6e-26 Score: 107
        LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKCQDSERTFY
  • 2. L11A011556    From 1 To 39 E-value: 3e-17 Score: 79
        LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDY
  • 3. L12A11486|    From 22 To 58 E-value: 7e-16 Score: 74.3
        [LL-37, 37 aa]
  • 4. L02A000624    From 2 To 38 E-value: 8e-16 Score: 74.3
        [LL-37, 37 aa]
  • 5. L07APD0026    From 3 To 39 E-value: 8e-16 Score: 74.3
        [LL-37, 37 aa]

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lozeau LD, Grosha J, Kole D, Prifti F, Dominko T, Camesano TA, Rolle MW
  •   Title:Collagen tethering of synthetic human antimicrobial peptides cathelicidin LL37 and its effects on antimicrobial activity and cytotoxicity
  •   Journal:Acta Biomater, 2017, 52, 9-20  [:28017866]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: