Record in detail


General Info

  • lamp_id:L11A012618
  • Name:Defensin NoD173 [A5R]
  • FullName:
  • Source:
  • Mass:5446.4 Da
  • Sequence Length:47 aa
  • Isoelectric Point:9.79
  • Activity:CancerMammalian Cell
  • Sequence
        RQCKRESNTFTGICIAKPPCRQACIREKFTDGHCSKVLRRCLCTKRC
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  12618

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A012618    From 1 To 47 E-value: 4e-22 Score: 95.1
        RQCKRESNTFTGICIAKPPCRQACIREKFTDGHCSKVLRRCLCTKRC
  • 2. L11A012616    From 1 To 47 E-value: 1e-21 Score: 93.2
        RQCKAESNTFTGICIAKPPCRQACIREKFTDGHCSKVLRRCLCTKRC
  • 3. L11A012617    From 1 To 47 E-value: 4e-21 Score: 91.7
        RQCKAESNTFTGICIAKPPCRKACIREKFTDGHCSKVLRRCLCTKRC
  • 4. L01A003064    From 1 To 47 E-value: 7e-19 Score: 84.3
        RECKTESNTFPGICITKPPCRKACISEKFTDGHCSKLLRRCLCTKPC
  • 5. L01A002688    From 1 To 47 E-value: 3e-18 Score: 82
        RECKTESNTFPGICITKPPCRKACISEKFTDGHCSKILRRCLCTKPC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lay FT, Ryan GF, Caria S, Phan TK, Veneer PK, White JA, Kvansakul M, Hulett MD
  •   Title:Structural and functional characterization of the membrane-permeabilizing activity of nicotiana occidentalis defensin noD173 and protein engineering to enhance oncolysis
  •   Journal:FASEB J, 2019  [:30794440]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: