Record in detail
General Info
- lamp_id:L01A000010
- Name:DFB11_BOVIN
- FullName:Beta-defensin 11
- Source:Bos taurus
- Mass:4163 Da
- Sequence Length:38 aa
- Isoelectric Point:10.09
- Activity:Antibacterial
- Sequence
GPLSCRRNGGVCIPIRCPGPMRQIGTCFGRPVKCCRSW - Function:Has bactericidal activity. Active against E.coli ML35 and S.aureus 502A.
Cross-Linking
- Cross-linking
- 1 Database:APD 46
- 2 Database:CAMP CAMPSQ8
- 3 Database:dbAMP dbAMP_03926
- 4 Database:DRAMP DRAMP02868
- 5 Database:SATPdb satpdb14817
- 6 Database:Uniprot P46169
- 7 Database:AMD BD11_BOVIN
- 8 Database:DEF DEF80
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A09080| From 23 To 60 E-value: 2e-17 Score: 79.7
GPLSCRRNGGVCIPIRCPGPMRQIGTCFGRPVKCCRSW - 2. L12A02357| From 7 To 44 E-value: 9e-17 Score: 77.4
GPLSCRRNGGVCIPIRCPGPMRQIGTCFGRPVKCCRSW - 3. L01A000010 From 1 To 38 E-value: 1e-16 Score: 76.6
GPLSCRRNGGVCIPIRCPGPMRQIGTCFGRPVKCCRSW - 4. L03A000070 From 16 To 53 E-value: 0.000000000000001 Score: 73.9
GPLSCRRKGGICILIRCPGPMRQIGTCFGRPVKCCRSW - 5. L03A000261 From 23 To 60 E-value: 0.000000000000002 Score: 72.8
GPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW
Activity
- Antibacterial Activities
- 1 Target: S. aureus MIC: 10 μg/ml (2.40211 μM)
- 2 Target: E. coli MIC: 10 μg/ml (2.40211 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Novotny M.J.,McGuire P.A.,Morris W.L.,Tang Y.-Q.,Selsted M.E.,
- Title:Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils.
- Journal:J. Biol. Chem., 1993, 268, 6641-6648 [MEDLINE:93203264]
- [2] Kalm E.,Schroder J.M.,Paul S.,Exner K.,Roosen S.,
- Title:Bovine beta-defensins: identification and characterization of novel bovine beta-defensin genes and their expression in mammary gland tissue.
- Journal:Mamm. Genome, 2004, 15, 834-842 [PubMed:15520886]
Comments
- Comments
No comments found on LAMP database