Record in detail


General Info

  • lamp_id:L01A000029
  • Name:ACBP_PIG
  • FullName:Acyl-CoA-binding protein
  • Source:Sus scrofa
  • Mass:6150.1 Da
  • Sequence Length:55 aa
  • Isoelectric Point:10.14
  • Activity:Antibacterial
  • Sequence
        KQATVGDINTERPGILDLKGKAKWDAWNGLKGTSKEDAMKAYINKVEELKKKYGI
  • Function:Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09389|    From 33 To 87 E-value: 3e-27 Score: 112
        KQATVGDINTERPGILDLKGKAKWDAWNGLKGTSKEDAMKAYINKVEELKKKYGI
  • 2. L01A000029    From 1 To 55 E-value: 1e-26 Score: 110
        KQATVGDINTERPGILDLKGKAKWDAWNGLKGTSKEDAMKAYINKVEELKKKYGI

Structure

  •   Domains
  •   1  Name:Acyl-CoA-binding_prot_CS    Interpro Link:IPR022408
  •   2  Name:Acyl-CoA-binding_protein    Interpro Link:IPR000582
  •   3  Name:FERM/acyl-CoA-bd_prot_3-hlx    Interpro Link:IPR014352
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  B. megaterium Bmll  MIC:  4.24 μg/ml  (0.68942 μM)  
  •   2  Target:  E. coli. D22  MIC:  184.5 μg/ml  (29.9995 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Mutt V.,Andersson M.,Gell K.,Agerberth B.,Chen Z.W.,
  •   Title:Isolation and characterization of porcine diazepam-binding inhibitor, a polypeptide not only of cerebral occurrence but also common in intestinal tissues and with effects on regulation of insulin release.
  •   Journal:Eur. J. Biochem., 1988, 174, 239-245  [MEDLINE:88254787]
  •   [2]  Mutt V.,Joernvall H.,Andersson M.,Boman A.,Agerberth B.,
  •   Title:Isolation of three antibacterial peptides from pig intestine: gastric inhibitory polypeptide (7-42), diazepam-binding inhibitor (32-86) and a novel factor, peptide 3910.
  •   Journal:Eur. J. Biochem., 1993, 216, 623-629  [MEDLINE:93387315]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: