Record in detail


General Info

  • lamp_id:L01A000040
  • Name:BDS1_ANESU
  • FullName:Antihypertensive protein BDS-1
  • Source:Anemonia sulcata
  • Mass:4714.4 Da
  • Sequence Length:43 aa
  • Isoelectric Point:8.37
  • Activity:Antiviral
  • Sequence
        AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH
  • Function:Blocks specifically the Kv3.4/KCNC4 potassium channel. Reduces blood pressure.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000040    From 1 To 43 E-value: 9e-21 Score: 90.5
        AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH

Structure

  •   Domains
  •   1  Name:BDS_K_chnl_tox    Interpro Link:IPR012414
  •   2  Name:Myo_neuro_toxin    Interpro Link:IPR023355
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Gronenborn A.M.,Beress L.,Clore G.M.,Driscoll P.C.,
  •   Title:A proton nuclear magnetic resonance study of the antihypertensive and antiviral protein BDS-I from the sea anemone Anemonia sulcata: sequential and stereospecific resonance assignment and secondary structure.
  •   Journal:Biochemistry, 1989, 28, 2178-2187  [MEDLINE:89247411]
  •   [2]  Clore G.M.,Beress L.,Gronenborn A.M.,Driscoll P.C.,
  •   Title:Determination of the three-dimensional solution structure of the antihypertensive and antiviral protein BDS-I from the sea anemone Anemonia sulcata: a study using nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing.
  •   Journal:Biochemistry, 1989, 28, 2188-2198  [MEDLINE:89247412]
  •   [3]  Lazdunski M.,Beress L.,Schweitz H.,Diochot S.,
  •   Title:Sea anemone peptides with a specific blocking activity against the fast inactivating potassium channel Kv3.4.
  •   Journal:J. Biol. Chem., 1998, 273, 6744-6749  [MEDLINE:98175936]

Comments

  •   Comments
  •   [1]  herbal xtc <a href=https://www.bizcommunity.com/Profile/Achetersibutraminesansordon>https://www.bizcommunity.com/Profile/Achetersibutraminesansordon</a> cigarette smoke remediation
  •   ----  i.n.n.a.a.t.a.k.o.va92@gmail.com   at  2020-12-07 17:28:16



CAPTCHA Image   Reload Image
Enter Code*: