Record in detail
General Info
- lamp_id:L01A000040
- Name:BDS1_ANESU
- FullName:Antihypertensive protein BDS-1
- Source:Anemonia sulcata
- Mass:4714.4 Da
- Sequence Length:43 aa
- Isoelectric Point:8.37
- Activity:Antiviral
- Sequence
AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH - Function:Blocks specifically the Kv3.4/KCNC4 potassium channel. Reduces blood pressure.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ1178
- 2 Database:dbAMP dbAMP_00056
- 3 Database:Uniprot P11494
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000040 From 1 To 43 E-value: 9e-21 Score: 90.5
AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Gronenborn A.M.,Beress L.,Clore G.M.,Driscoll P.C.,
- Title:A proton nuclear magnetic resonance study of the antihypertensive and antiviral protein BDS-I from the sea anemone Anemonia sulcata: sequential and stereospecific resonance assignment and secondary structure.
- Journal:Biochemistry, 1989, 28, 2178-2187 [MEDLINE:89247411]
- [2] Clore G.M.,Beress L.,Gronenborn A.M.,Driscoll P.C.,
- Title:Determination of the three-dimensional solution structure of the antihypertensive and antiviral protein BDS-I from the sea anemone Anemonia sulcata: a study using nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing.
- Journal:Biochemistry, 1989, 28, 2188-2198 [MEDLINE:89247412]
- [3] Lazdunski M.,Beress L.,Schweitz H.,Diochot S.,
- Title:Sea anemone peptides with a specific blocking activity against the fast inactivating potassium channel Kv3.4.
- Journal:J. Biol. Chem., 1998, 273, 6744-6749 [MEDLINE:98175936]
Comments
- Comments
- [1] herbal xtc <a href=https://www.bizcommunity.com/Profile/Achetersibutraminesansordon>https://www.bizcommunity.com/Profile/Achetersibutraminesansordon</a> cigarette smoke remediation
- ---- i.n.n.a.a.t.a.k.o.va92@gmail.com at 2020-12-07 17:28:16